Property Summary

NCBI Gene PubMed Count 37
PubMed Score 59.27
PubTator Score 41.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Epilepsy 792 0.0 4.0

Expression

  Differential Expression (30)

Disease log2 FC p
adrenocortical carcinoma -1.191 7.4e-03
aldosterone-producing adenoma -1.010 3.3e-02
Amyotrophic lateral sclerosis 1.123 1.8e-03
atypical teratoid / rhabdoid tumor -1.300 1.3e-02
autosomal dominant Emery-Dreifuss muscul... -1.241 3.1e-02
Breast cancer 3.700 2.2e-02
colon cancer 1.600 1.6e-04
cystic fibrosis -2.734 3.7e-08
diabetes mellitus -1.400 4.1e-03
Duchenne muscular dystrophy -1.022 6.1e-03
ductal carcinoma in situ 1.600 8.2e-03
group 3 medulloblastoma -1.600 2.2e-04
interstitial cystitis 1.400 6.8e-03
invasive ductal carcinoma 1.700 9.6e-03
lung adenocarcinoma 1.159 3.5e-05
lung carcinoma 1.800 1.9e-27
malignant mesothelioma 4.300 8.9e-09
medulloblastoma, large-cell -1.600 1.1e-02
Multiple myeloma 1.896 9.8e-04
non-small cell lung cancer 2.067 9.0e-22
osteosarcoma -1.900 1.7e-03
ovarian cancer -1.100 8.7e-04
pancreatic cancer -1.700 5.3e-04
Pick disease 1.300 1.5e-05
Polycystic ovary syndrome -1.771 2.0e-02
primary pancreatic ductal adenocarcinoma -1.570 3.0e-04
subependymal giant cell astrocytoma -1.987 1.4e-02
tuberculosis -1.500 5.8e-07
ulcerative colitis 1.400 6.3e-05
X-linked cerebral adrenoleukodystrophy 1.200 3.3e-02

 GWAS Trait (1)

Gene RIF (16)

AA Sequence

MEKSNETNGYLDSAQAGPAAGPGAPGTAAGRARRCAGFLRRQALVLLTVSGVLAGAGLGAALRGLSLSRT      1 - 70
QVTYLAFPGEMLLRMLRMIILPLVVCSLVSGAASLDASCLGRLGGIAVAYFGLTTLSASALAVALAFIIK     71 - 140
PGSGAQTLQSSDLGLEDSGPPPVPKETVDSFLDLARNLFPSNLVVAAFRTYATDYKVVTQNSSSGNVTHE    141 - 210
KIPIGTEIEGMNILGLVLFALVLGVALKKLGSEGEDLIRFFNSLNEATMVLVSWIMWYVPVGIMFLVGSK    211 - 280
IVEMKDIIVLVTSLGKYIFASILGHVIHGGIVLPLIYFVFTRKNPFRFLLGLLAPFATAFATCSSSATLP    281 - 350
SMMKCIEENNGVDKRISRFILPIGATVNMDGAAIFQCVAAVFIAQLNNVELNAGQIFTILVTATASSVGA    351 - 420
AGVPAGGVLTIAIILEAIGLPTHDLPLILAVDWIVDRTTTVVNVEGDALGAGILHHLNQKATKKGEQELA    421 - 490
EVKVEAIPNCKSEEETSPLVTHQNPAGPVASAPELESKESVL                                491 - 532
//

Text Mined References (46)

PMID Year Title