Property Summary

NCBI Gene PubMed Count 86
Grant Count 126
R01 Count 79
Funding $15,251,996.91
PubMed Score 368.76
PubTator Score 234.66

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P43005 O75587 Q5VZ24 Q8N199 Q9UEW2
Symbols DCBXA
EAAC1
EAAT3
SCZD18

Gene

PANTHER Protein Class (2)

Gene RIF (75)

PMID Text
26112741 SPAK and OSR1 are negative regulators of EAAT3 activity
26007177 Excitatory amino acid carrier 1 (EAAC1) plays a pivotal role in neuronal glutathione synthesis to maintain cellular redox homeostasis.
25445080 variability within the SLC1A1 gene impacts both the presence and severity of posttraumatic stress disorder among a sample of combat-exposed veterans.
25275463 Transport of either L-glutamate or L-selenocysteine by EAAT3 decreased intracellular pH, whereas transport of cysteine resulted in cytoplasmic alkalinization.
25033183 internalization of EAAT3 triggered by amphetamine increases glutamatergic signaling and thus contributes to the effects of amphetamine on neurotransmission.
24768158 Rs301430 is a T/C functional polymorphism that influences ago of onset in obsessive-compulsive disorder.
24214974 P259R alters EAAT3 transport functions by decelerating conformational changes associated with sodium binding.
24163246 Results indentify plausible candidates include non-recurrent deletions at the glutamate transporter gene SLC1A1, a CNV locus recently suggested to be involved in schizophrenia through linkage analysis, and duplications at 1p36.33 and CGNL1.
24162932 EAAT3/EAAC1 expression is altered in pathological conditions, such as hypoxia/ischemia, multiple sclerosis, schizophrenia, and epilepsy. (Review)
23931931 Our data suggest that SLC1A1 is unlikely to be a major susceptibility gene for schizophrenia in Han Chinese
More...

AA Sequence

MGKPARKGCEWKRFLKNNWVLLSTVAAVVLGITTGVLVREHSNLSTLEKFYFAFPGEILMRMLKLIILPL      1 - 70
IISSMITGVAALDSNVSGKIGLRAVVYYFCTTLIAVILGIVLVVSIKPGVTQKVGEIARTGSTPEVSTVD     71 - 140
AMLDLIRNMFPENLVQACFQQYKTKREEVKPPSDPEMNMTEESFTAVMTTAISKNKTKEYKIVGMYSDGI    141 - 210
NVLGLIVFCLVFGLVIGKMGEKGQILVDFFNALSDATMKIVQIIMCYMPLGILFLIAGKIIEVEDWEIFR    211 - 280
KLGLYMATVLTGLAIHSIVILPLIYFIVVRKNPFRFAMGMAQALLTALMISSSSATLPVTFRCAEENNQV    281 - 350
DKRITRFVLPVGATINMDGTALYEAVAAVFIAQLNDLDLGIGQIITISITATSASIGAAGVPQAGLVTMV    351 - 420
IVLSAVGLPAEDVTLIIAVDWLLDRFRTMVNVLGDAFGTGIVEKLSKKELEQMDVSSEVNIVNPFALEST    421 - 490
ILDNEDSDTKKSYVNGGFAVDKSDTISFTQTSQF                                        491 - 524
//

Text Mined References (87)

PMID Year Title
26112741 2015 SPAK and OSR1 Sensitivity of Excitatory Amino Acid Transporter EAAT3.
26007177 2015 Glutathione in Cellular Redox Homeostasis: Association with the Excitatory Amino Acid Carrier 1 (EAAC1).
25445080 2014 Variation in SLC1A1 is related to combat-related posttraumatic stress disorder.
25416956 2014 A proteome-scale map of the human interactome network.
25275463 2014 Cysteine transport through excitatory amino acid transporter 3 (EAAT3).
25033183 2014 Amphetamine modulates excitatory neurotransmission through endocytosis of the glutamate transporter EAAT3 in dopamine neurons.
24768158 2014 A single nucleotide polymorphism in SLC1A1 gene is associated with age of onset of obsessive-compulsive disorder.
24214974 2013 Mutating a conserved proline residue within the trimerization domain modifies Na+ binding to excitatory amino acid transporters and associated conformational changes.
24163246 2014 CNV analysis in a large schizophrenia sample implicates deletions at 16p12.1 and SLC1A1 and duplications at 1p36.33 and CGNL1.
24162932 2014 Changes in the expression of the glutamate transporter EAAT3/EAAC1 in health and disease.
More...