Property Summary

Ligand Count 27
NCBI Gene PubMed Count 132
PubMed Score 939.64
PubTator Score 406.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Movement disease 11 0.0 2.7
Vitiligo 73 0.0 3.0

Expression

  Differential Expression (20)

Disease log2 FC p
adrenocortical carcinoma -2.575 2.1e-04
adult high grade glioma -1.200 2.1e-02
astrocytoma -1.700 5.8e-07
Astrocytoma, Pilocytic -1.300 9.4e-03
atypical teratoid / rhabdoid tumor -2.300 4.3e-06
ependymoma -2.500 1.0e-04
gastric carcinoma -1.500 5.1e-03
glioblastoma -2.200 1.2e-03
group 3 medulloblastoma -3.100 4.3e-02
intraductal papillary-mucinous adenoma (... -2.000 7.1e-04
intraductal papillary-mucinous carcinoma... -1.800 3.2e-03
intraductal papillary-mucinous neoplasm ... -2.000 9.8e-03
lung carcinoma 1.800 2.8e-21
medulloblastoma, large-cell -1.700 1.3e-02
oligodendroglioma 2.400 3.6e-03
pancreatic cancer -1.400 1.1e-03
Pick disease -2.800 7.4e-03
primary pancreatic ductal adenocarcinoma -2.579 5.9e-05
primitive neuroectodermal tumor -2.000 7.8e-04
progressive supranuclear palsy -1.400 4.3e-02

Gene RIF (107)

AA Sequence

MASTEGANNMPKQVEVRMHDSHLGSEEPKHRHLGLRLCDKLGKNLLLTLTVFGVILGAVCGGLLRLASPI      1 - 70
HPDVVMLIAFPGDILMRMLKMLILPLIISSLITGLSGLDAKASGRLGTRAMVYYMSTTIIAAVLGVILVL     71 - 140
AIHPGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTKKVLVAPPPDEEANATSA    141 - 210
VVSLLNETVTEVPEETKMVIKKGLEFKDGMNVLGLIGFFIAFGIAMGKMGDQAKLMVDFFNILNEIVMKL    211 - 280
VIMIMWYSPLGIACLICGKIIAIKDLEVVARQLGMYMVTVIIGLIIHGGIFLPLIYFVVTRKNPFSFFAG    281 - 350
IFQAWITALGTASSAGTLPVTFRCLEENLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVVL    351 - 420
DGGQIVTVSLTATLASVGAASIPSAGLVTMLLILTAVGLPTEDISLLVAVDWLLDRMRTSVNVVGDSFGA    421 - 490
GIVYHLSKSELDTIDSQHRVHEDIEMTKTQSIYDDMKNHRESNSNQCVYAAHNSVIVDECKVTLAANGKS    491 - 560
ADCSVEEEPWKREK                                                            561 - 574
//

Text Mined References (134)

PMID Year Title