Property Summary

NCBI Gene PubMed Count 123
Grant Count 336
R01 Count 224
Funding $74,958,481.73
PubMed Score 869.16
PubTator Score 406.46

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P43004 B4DQE9 Q14417 Q541G6 U3KQQ4
Symbols HBGT
EAAT2
GLT-1
EIEE41

Gene

PANTHER Protein Class (2)

Gene RIF (100)

PMID Text
26483543 The Hydroxyl Side Chain of a Highly Conserved Serine Residue Is Required for Cation Selectivity and Substrate Transport in the Glial Glutamate Transporter GLT-1/SLC1A2.
26459047 Results suggest that genetic variation (rs4354668 and its haplotypes) in SLC1A2 may be involved in impaired executive function, which adds to the current body of knowledge regarding the risk of schizophrenia and the impairment of cognitive performance
26313486 The results of the meta-analysis suggest that rs3794087 is not associated with the risk for essential tremor. Systematic review and meta-analysis.
26233565 SPAK and OSR1 are powerful negative regulators of the excitatory glutamate transporters EAAT1 and EAAT2.
26057049 Splice variant EAAT2b levels are increased in populations of anterior cingulate cortex pyramidal cells in schizophrenic patients.
26046374 PPARgamma agonist pioglitazone has a role in modulating EAAT2 expression in glioma cells
25406999 Two recurrent SLC1A2 missense variants and one recurrent 5'-untranslated region variant were found to be associated with susceptibility to the development of bipolar disorder and schizophrenia.
25391854 Results showed that EAAT2 levels were significantly decreased in the essential tremor cerebellar cortex, in contrast to similar levels of EAAT1 levels between essential tremor cases and controls
25064059 Results describe EAAT1 and EAAT2 labeling in the prefrontal cortex in human postmortem control brains at the light and electron microscopic level
25064045 transcriptional factor yin yang 1 plays a critical role in the repressive effects of various neurotoxins, such as manganese (Mn), on EAAT2 expression. In this review, we will focus on transcriptional epigenetics and translational regulation of EAAT2
More...

AA Sequence

MASTEGANNMPKQVEVRMHDSHLGSEEPKHRHLGLRLCDKLGKNLLLTLTVFGVILGAVCGGLLRLASPI      1 - 70
HPDVVMLIAFPGDILMRMLKMLILPLIISSLITGLSGLDAKASGRLGTRAMVYYMSTTIIAAVLGVILVL     71 - 140
AIHPGNPKLKKQLGPGKKNDEVSSLDAFLDLIRNLFPENLVQACFQQIQTVTKKVLVAPPPDEEANATSA    141 - 210
VVSLLNETVTEVPEETKMVIKKGLEFKDGMNVLGLIGFFIAFGIAMGKMGDQAKLMVDFFNILNEIVMKL    211 - 280
VIMIMWYSPLGIACLICGKIIAIKDLEVVARQLGMYMVTVIIGLIIHGGIFLPLIYFVVTRKNPFSFFAG    281 - 350
IFQAWITALGTASSAGTLPVTFRCLEENLGIDKRVTRFVLPVGATINMDGTALYEAVAAIFIAQMNGVVL    351 - 420
DGGQIVTVSLTATLASVGAASIPSAGLVTMLLILTAVGLPTEDISLLVAVDWLLDRMRTSVNVVGDSFGA    421 - 490
GIVYHLSKSELDTIDSQHRVHEDIEMTKTQSIYDDMKNHRESNSNQCVYAAHNSVIVDECKVTLAANGKS    491 - 560
ADCSVEEEPWKREK                                                            561 - 574
//

Text Mined References (125)

PMID Year Title
26483543 2015 The Hydroxyl Side Chain of a Highly Conserved Serine Residue Is Required for Cation Selectivity and Substrate Transport in the Glial Glutamate Transporter GLT-1/SLC1A2.
26459047 2015 Common variants in SLC1A2 and schizophrenia: Association and cognitive function in patients with schizophrenia and healthy individuals.
26313486 2015 SLC1A2 rs3794087 variant and risk for essential tremor: a systematic review and meta-analysis.
26233565 2015 Down-Regulation of Excitatory Amino Acid Transporters EAAT1 and EAAT2 by the Kinases SPAK and OSR1.
26057049 2015 Glutamate transporter splice variant expression in an enriched pyramidal cell population in schizophrenia.
26046374 2015 The peroxisome proliferator activated receptor gamma agonist pioglitazone increases functional expression of the glutamate transporter excitatory amino acid transporter 2 (EAAT2) in human glioblastoma cells.
25406999 2015 Association of rare variation in the glutamate receptor gene SLC1A2 with susceptibility to bipolar disorder and schizophrenia.
25391854 2014 Decreased EAAT2 protein expression in the essential tremor cerebellar cortex.
25064059 2014 Localization of excitatory amino acid transporters EAAT1 and EAAT2 in human postmortem cortex: a light and electron microscopic study.
25064045 2015 Genetic dys-regulation of astrocytic glutamate transporter EAAT2 and its implications in neurological disorders and manganese toxicity.
More...