Property Summary

NCBI Gene PubMed Count 79
Grant Count 131
R01 Count 83
Funding $16,219,280.65
PubMed Score 522.49
PubTator Score 247.77

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P43003 B2R5T3 Q4JCQ8
Symbols EA6
EAAT1
GLAST
GLAST1

Gene

PANTHER Protein Class (2)

Gene RIF (60)

PMID Text
26233565 SPAK and OSR1 are powerful negative regulators of the excitatory glutamate transporters EAAT1 and EAAT2.
26203187 data provide additional insights into the mechanism by which substrates gate the anion conductance in EAATs and suggest that in EAAT1, Arg-388 is a critical element for the structural coupling between the substrate translocation and the gating mechanisms
26057049 There was no association between pyramidal cell EAAT1 splice variant expression and schizophrenia.
25789968 discovering compounds that can enhance EAAT1 expression and activity may be a novel strategy for therapeutic treatment of glaucoma.
25660734 EAAT1 polymorphism which is involved in the Regulation of extracellular glutamate concentrations, influences Cognitive performances with a detrimental effect of T/T homozygosis.
25391854 Results showed that EAAT2 levels were significantly decreased in the essential tremor cerebellar cortex, in contrast to similar levels of EAAT1 levels between essential tremor cases and controls
25064059 Results describe EAAT1 and EAAT2 labeling in the prefrontal cortex in human postmortem control brains at the light and electron microscopic level
25036385 the delivered miR-124 increased the expression of the glutamate transporters, EAAT1 in NPCs and EAAT2 in both NPCs and astrocytes.
24332449 Its dysregulation may contribute to the pathology and possibly affect the onset of fragile X-associated tremor/ataxia syndrome.
23913256 Plasma membrane EAAT1 (and NCX1)are both involved in glutamate-induced ATP synthesis.
More...

AA Sequence

MTKSNGEEPKMGGRMERFQQGVRKRTLLAKKKVQNITKEDVKSYLFRNAFVLLTVTAVIVGTILGFTLRP      1 - 70
YRMSYREVKYFSFPGELLMRMLQMLVLPLIISSLVTGMAALDSKASGKMGMRAVVYYMTTTIIAVVIGII     71 - 140
IVIIIHPGKGTKENMHREGKIVRVTAADAFLDLIRNMFPPNLVEACFKQFKTNYEKRSFKVPIQANETLV    141 - 210
GAVINNVSEAMETLTRITEELVPVPGSVNGVNALGLVVFSMCFGFVIGNMKEQGQALREFFDSLNEAIMR    211 - 280
LVAVIMWYAPVGILFLIAGKIVEMEDMGVIGGQLAMYTVTVIVGLLIHAVIVLPLLYFLVTRKNPWVFIG    281 - 350
GLLQALITALGTSSSSATLPITFKCLEENNGVDKRVTRFVLPVGATINMDGTALYEALAAIFIAQVNNFE    351 - 420
LNFGQIITISITATAASIGAAGIPQAGLVTMVIVLTSVGLPTDDITLIIAVDWFLDRLRTTTNVLGDSLG    421 - 490
AGIVEHLSRHELKNRDVEMGNSVIEENEMKKPYQLIAQDNETEKPIDSETKM                      491 - 542
//

Text Mined References (83)

PMID Year Title
26233565 2015 Down-Regulation of Excitatory Amino Acid Transporters EAAT1 and EAAT2 by the Kinases SPAK and OSR1.
26203187 2015 A Mutation in Transmembrane Domain 7 (TM7) of Excitatory Amino Acid Transporters Disrupts the Substrate-dependent Gating of the Intrinsic Anion Conductance and Drives the Channel into a Constitutively Open State.
26057049 2015 Glutamate transporter splice variant expression in an enriched pyramidal cell population in schizophrenia.
25789968 2015 Arundic acid attenuates retinal ganglion cell death by increasing glutamate/aspartate transporter expression in a model of normal tension glaucoma.
25660734 2015 Glutamate EAAT1 transporter genetic variants influence cognitive deficits in bipolar disorder.
25391854 2014 Decreased EAAT2 protein expression in the essential tremor cerebellar cortex.
25064059 2014 Localization of excitatory amino acid transporters EAAT1 and EAAT2 in human postmortem cortex: a light and electron microscopic study.
25036385 2014 Mesenchymal stem cells deliver exogenous miRNAs to neural cells and induce their differentiation and glutamate transporter expression.
24332449 2014 Reduced excitatory amino acid transporter 1 and metabotropic glutamate receptor 5 expression in the cerebellum of fragile X mental retardation gene 1 premutation carriers with fragile X-associated tremor/ataxia syndrome.
23913256 2013 Glutamate-induced ATP synthesis: relationship between plasma membrane Na+/Ca2+ exchanger and excitatory amino acid transporters in brain and heart cell models.
More...