Property Summary

NCBI Gene PubMed Count 110
Grant Count 47
R01 Count 34
Funding $5,545,974.21
PubMed Score 336.69
PubTator Score 309.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Gene RIF (83)

PMID Text
26543229 CK2-increased ECE-1c protein stability is related to augmented migration and invasion of colon cancer cells, shedding light on a novel mechanism by which CK2 may promote malignant progression of this disease.
25501500 Structural analysis of membrane-bound hECE-1 dimer using molecular modeling techniques: insights into conformational changes and Abeta1-42 peptide binding.
25469848 Thus, our findings suggest that ECE-1 may be a novel hypoxia-inducible factor-target gene.
25268585 confirmed that endothelin-converting enzyme 1 (ECE1), EDN1, and EDNRB were involved in SP-induced pigmentation and found that EDN1 secretion was affected by ECE1 and EDN1 siRNAs, but not by EDNRB siRNA
25226840 Nitric oxide inhibits the production of soluble endothelin converting enzyme-1 by endothelial cells.
25179465 An arterial-specific enhancer of the human endothelin converting enzyme 1 (ECE1) gene is synergistically activated by Sox17, FoxC2, and Etv2
24898255 the primary function of betaARRs and ECE-1 in SP-dependent inflammatory signaling is to promote resensitization, which allows the sustained NK1R signaling from the plasma membrane that drives inflammation
24812665 identify the neural peptidase ECE-1 as a negative regulator of itch on sensory nerves by directly regulating ET-1-induced pruritus
24595843 Compared with rs213045 G homozygote, rs213045 TG genotype and rs213045 TT/TG genotypes are in dominant model significantly increased the risk of ischemic stroke.
24497914 Data indicate endothelin-converting enzyme-1 (ECE-1) as a target for alternative polyadenylation (APA), a regulatory mechanism aberrantly activated in cancer cells, and the mechanisms leading to ECE-1 overexpression in malignant cells.
More...

AA Sequence

MRGVWPPPVSALLSALGMSTYKRATLDEEDLVDSLSEGDAYPNGLQVNFHSPRSGQRCWAARTQVEKRLV      1 - 70
VLVVLLAAGLVACLAALGIQYQTRSPSVCLSEACVSVTSSILSSMDPTVDPCHDFFSYACGGWIKANPVP     71 - 140
DGHSRWGTFSNLWEHNQAIIKHLLENSTASVSEAERKAQVYYRACMNETRIEELRAKPLMELIERLGGWN    141 - 210
ITGPWAKDNFQDTLQVVTAHYRTSPFFSVYVSADSKNSNSNVIQVDQSGLGLPSRDYYLNKTENEKVLTG    211 - 280
YLNYMVQLGKLLGGGDEEAIRPQMQQILDFETALANITIPQEKRRDEELIYHKVTAAELQTLAPAINWLP    281 - 350
FLNTIFYPVEINESEPIVVYDKEYLEQISTLINTTDRCLLNNYMIWNLVRKTSSFLDQRFQDADEKFMEV    351 - 420
MYGTKKTCLPRWKFCVSDTENNLGFALGPMFVKATFAEDSKSIATEIILEIKKAFEESLSTLKWMDEETR    421 - 490
KSAKEKADAIYNMIGYPNFIMDPKELDKVFNDYTAVPDLYFENAMRFFNFSWRVTADQLRKAPNRDQWSM    491 - 560
TPPMVNAYYSPTKNEIVFPAGILQAPFYTRSSPKALNFGGIGVVVGHELTHAFDDQGREYDKDGNLRPWW    561 - 630
KNSSVEAFKRQTECMVEQYSNYSVNGEPVNGRHTLGENIADNGGLKAAYRAYQNWVKKNGAEHSLPTLGL    631 - 700
TNNQLFFLGFAQVWCSVRTPESSHEGLITDPHSPSRFRVIGSLSNSKEFSEHFRCPPGSPMNPPHKCEVW    701 - 770
//

Text Mined References (116)

PMID Year Title
26543229 2015 Colon cancer cell invasion is promoted by protein kinase CK2 through increase of endothelin-converting enzyme-1c protein stability.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25501500 2015 Structural analysis of membrane-bound hECE-1 dimer using molecular modeling techniques: insights into conformational changes and A?1-42 peptide binding.
25469848 2015 Endothelin-converting enzyme is a plausible target gene for hypoxia-inducible factor.
25416956 2014 A proteome-scale map of the human interactome network.
25268585 2015 Substance P stimulates endothelin 1 secretion via endothelin-converting enzyme 1 and promotes melanogenesis in human melanocytes.
25226840 2014 Nitric oxide inhibits the production of soluble endothelin converting enzyme-1.
25179465 2014 An arterial-specific enhancer of the human endothelin converting enzyme 1 (ECE1) gene is synergistically activated by Sox17, FoxC2, and Etv2.
24898255 2014 Endothelin-converting enzyme 1 and ?-arrestins exert spatiotemporal control of substance P-induced inflammatory signals.
24812665 2014 Neural peptidase endothelin-converting enzyme 1 regulates endothelin 1-induced pruritus.
More...