Property Summary

Ligand Count 256
NCBI Gene PubMed Count 113
PubMed Score 355.04
PubTator Score 309.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count
Acute diarrhea 2
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count
Hirschsprung's disease 46

Expression

  Differential Expression (3)

Disease log2 FC p
mucosa-associated lymphoid tissue lympho... 1.437 6.1e-03
ovarian cancer -1.100 7.7e-05
subependymal giant cell astrocytoma 1.177 5.6e-03

Gene RIF (86)

AA Sequence

MRGVWPPPVSALLSALGMSTYKRATLDEEDLVDSLSEGDAYPNGLQVNFHSPRSGQRCWAARTQVEKRLV      1 - 70
VLVVLLAAGLVACLAALGIQYQTRSPSVCLSEACVSVTSSILSSMDPTVDPCHDFFSYACGGWIKANPVP     71 - 140
DGHSRWGTFSNLWEHNQAIIKHLLENSTASVSEAERKAQVYYRACMNETRIEELRAKPLMELIERLGGWN    141 - 210
ITGPWAKDNFQDTLQVVTAHYRTSPFFSVYVSADSKNSNSNVIQVDQSGLGLPSRDYYLNKTENEKVLTG    211 - 280
YLNYMVQLGKLLGGGDEEAIRPQMQQILDFETALANITIPQEKRRDEELIYHKVTAAELQTLAPAINWLP    281 - 350
FLNTIFYPVEINESEPIVVYDKEYLEQISTLINTTDRCLLNNYMIWNLVRKTSSFLDQRFQDADEKFMEV    351 - 420
MYGTKKTCLPRWKFCVSDTENNLGFALGPMFVKATFAEDSKSIATEIILEIKKAFEESLSTLKWMDEETR    421 - 490
KSAKEKADAIYNMIGYPNFIMDPKELDKVFNDYTAVPDLYFENAMRFFNFSWRVTADQLRKAPNRDQWSM    491 - 560
TPPMVNAYYSPTKNEIVFPAGILQAPFYTRSSPKALNFGGIGVVVGHELTHAFDDQGREYDKDGNLRPWW    561 - 630
KNSSVEAFKRQTECMVEQYSNYSVNGEPVNGRHTLGENIADNGGLKAAYRAYQNWVKKNGAEHSLPTLGL    631 - 700
TNNQLFFLGFAQVWCSVRTPESSHEGLITDPHSPSRFRVIGSLSNSKEFSEHFRCPPGSPMNPPHKCEVW    701 - 770
//

Text Mined References (119)

PMID Year Title