Property Summary

NCBI Gene PubMed Count 110
PubMed Score 336.69
PubTator Score 309.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Gene

PANTHER Protein Class (3)

PDB

3DWB  

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Platypus OMA Inparanoid

Gene RIF (83)

PMID Text
26543229 CK2-increased ECE-1c protein stability is related to augmented migration and invasion of colon cancer cells, shedding light on a novel mechanism by which CK2 may promote malignant progression of this disease.
25501500 Structural analysis of membrane-bound hECE-1 dimer using molecular modeling techniques: insights into conformational changes and Abeta1-42 peptide binding.
25469848 Thus, our findings suggest that ECE-1 may be a novel hypoxia-inducible factor-target gene.
25268585 confirmed that endothelin-converting enzyme 1 (ECE1), EDN1, and EDNRB were involved in SP-induced pigmentation and found that EDN1 secretion was affected by ECE1 and EDN1 siRNAs, but not by EDNRB siRNA
25226840 Nitric oxide inhibits the production of soluble endothelin converting enzyme-1 by endothelial cells.
25179465 An arterial-specific enhancer of the human endothelin converting enzyme 1 (ECE1) gene is synergistically activated by Sox17, FoxC2, and Etv2
24898255 the primary function of betaARRs and ECE-1 in SP-dependent inflammatory signaling is to promote resensitization, which allows the sustained NK1R signaling from the plasma membrane that drives inflammation
24812665 identify the neural peptidase ECE-1 as a negative regulator of itch on sensory nerves by directly regulating ET-1-induced pruritus
24595843 Compared with rs213045 G homozygote, rs213045 TG genotype and rs213045 TT/TG genotypes are in dominant model significantly increased the risk of ischemic stroke.
24497914 Data indicate endothelin-converting enzyme-1 (ECE-1) as a target for alternative polyadenylation (APA), a regulatory mechanism aberrantly activated in cancer cells, and the mechanisms leading to ECE-1 overexpression in malignant cells.
More...

AA Sequence

MRGVWPPPVSALLSALGMSTYKRATLDEEDLVDSLSEGDAYPNGLQVNFHSPRSGQRCWAARTQVEKRLV      1 - 70
VLVVLLAAGLVACLAALGIQYQTRSPSVCLSEACVSVTSSILSSMDPTVDPCHDFFSYACGGWIKANPVP     71 - 140
DGHSRWGTFSNLWEHNQAIIKHLLENSTASVSEAERKAQVYYRACMNETRIEELRAKPLMELIERLGGWN    141 - 210
ITGPWAKDNFQDTLQVVTAHYRTSPFFSVYVSADSKNSNSNVIQVDQSGLGLPSRDYYLNKTENEKVLTG    211 - 280
YLNYMVQLGKLLGGGDEEAIRPQMQQILDFETALANITIPQEKRRDEELIYHKVTAAELQTLAPAINWLP    281 - 350
FLNTIFYPVEINESEPIVVYDKEYLEQISTLINTTDRCLLNNYMIWNLVRKTSSFLDQRFQDADEKFMEV    351 - 420
MYGTKKTCLPRWKFCVSDTENNLGFALGPMFVKATFAEDSKSIATEIILEIKKAFEESLSTLKWMDEETR    421 - 490
KSAKEKADAIYNMIGYPNFIMDPKELDKVFNDYTAVPDLYFENAMRFFNFSWRVTADQLRKAPNRDQWSM    491 - 560
TPPMVNAYYSPTKNEIVFPAGILQAPFYTRSSPKALNFGGIGVVVGHELTHAFDDQGREYDKDGNLRPWW    561 - 630
KNSSVEAFKRQTECMVEQYSNYSVNGEPVNGRHTLGENIADNGGLKAAYRAYQNWVKKNGAEHSLPTLGL    631 - 700
TNNQLFFLGFAQVWCSVRTPESSHEGLITDPHSPSRFRVIGSLSNSKEFSEHFRCPPGSPMNPPHKCEVW    701 - 770
//

Text Mined References (116)

PMID Year Title
26543229 2015 Colon cancer cell invasion is promoted by protein kinase CK2 through increase of endothelin-converting enzyme-1c protein stability.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25501500 2015 Structural analysis of membrane-bound hECE-1 dimer using molecular modeling techniques: insights into conformational changes and A?1-42 peptide binding.
25469848 2015 Endothelin-converting enzyme is a plausible target gene for hypoxia-inducible factor.
25416956 2014 A proteome-scale map of the human interactome network.
25268585 2015 Substance P stimulates endothelin 1 secretion via endothelin-converting enzyme 1 and promotes melanogenesis in human melanocytes.
25226840 2014 Nitric oxide inhibits the production of soluble endothelin converting enzyme-1.
25179465 2014 An arterial-specific enhancer of the human endothelin converting enzyme 1 (ECE1) gene is synergistically activated by Sox17, FoxC2, and Etv2.
24898255 2014 Endothelin-converting enzyme 1 and ?-arrestins exert spatiotemporal control of substance P-induced inflammatory signals.
24812665 2014 Neural peptidase endothelin-converting enzyme 1 regulates endothelin 1-induced pruritus.
More...