Property Summary

NCBI Gene PubMed Count 13
PubMed Score 16.11
PubTator Score 14.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Gene RIF (4)

AA Sequence

MVKLGNNFAEKGTKQPLLEDGFDTIPLMTPLDVNQLQFPPPDKVVVKTKTEYEPDRKKGKARPPQIAEFT      1 - 70
VSITEGVTERFKVSVLVLFALAFLTCVVFLVVYKVYKYDRACPDGFVLKNTQCIPEGLESYYAEQDSSAR     71 - 140
EKFYTVINHYNLAKQSITRSVSPWMSVLSEEKLSEQETEAAEKSA                             141 - 185
//

Text Mined References (14)

PMID Year Title