Property Summary

NCBI Gene PubMed Count 11
Grant Count 15
R01 Count 8
Funding $1,008,582.44
PubMed Score 14.01
PubTator Score 14.08

Knowledge Summary

Patent

No data available

Gene RIF (4)

PMID Text
25376768 This review focuses on two closely related, neuron-enriched endosomal proteins: NEEP21 and Calcyon which perform distinct roles in regulating receptor endocytosis, recycling, and degradation--{REVIEW}
21084623 NEEP21 profoundly affects the processing of beta-amyloid precursor proteins and Abeta peptide production.
20878061 These results suggest that NEEP21 may play a critical role in apoptosis as a mediator of p53.
20599942 a novel p53-responsive gene D4S234E is accumulated in the ER and induces apoptosis in response to DNA damage.

AA Sequence

MVKLGNNFAEKGTKQPLLEDGFDTIPLMTPLDVNQLQFPPPDKVVVKTKTEYEPDRKKGKARPPQIAEFT      1 - 70
VSITEGVTERFKVSVLVLFALAFLTCVVFLVVYKVYKYDRACPDGFVLKNTQCIPEGLESYYAEQDSSAR     71 - 140
EKFYTVINHYNLAKQSITRSVSPWMSVLSEEKLSEQETEAAEKSA                             141 - 185
//

Publication (12)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25376768 2015 Complementary roles of the neuron-enriched endosomal proteins NEEP21 and calcyon in neuronal vesicle trafficking.
21084623 2010 Identification of NEEP21 as a ß-amyloid precursor protein-interacting protein in vivo that modulates amyloidogenic processing in vitro.
20878061 2010 Identification of NEEP21, encoding neuron-enriched endosomal protein of 21 kDa, as a transcriptional target of tumor suppressor p53.
20599942 2010 D4S234E, a novel p53-responsive gene, induces apoptosis in response to DNA damage.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...