Property Summary

NCBI Gene PubMed Count 100
Grant Count 61
R01 Count 43
Funding $5,133,194.12
PubMed Score 240.95
PubTator Score 188.67

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P42830 Q96QE1
Symbols SCYB5
ENA-78

Gene

PDB

2MGS  

Gene RIF (74)

PMID Text
26287498 CXCL5 expression is enriched in human atherosclerotic coronary artery. The CXCL5 variant might be a genetic risk factor for the susceptibility of CAD and the CXCL5 promoter -156 G/C C allele might be an independent predictor for CAD.
26058729 Study shows that CXCL5 expression is elevated in positive correlation to bladder cancer grade and promotes cell migration and invasion via binding to its receptor CXCR2.
25871636 Serum levels of ENA-78 were elevated in autistic children and they were significantly associated with the increased levels of serum antineuronal auto-antibodies
25788272 There was an inverse correlation between DACH1 mRNA levels and CXCL5 in both lung cancer cell lines and human NSCLC tissues.
25738378 High CXCL5 expression is associated with pediatric ulcerative colitis.
25690483 Analysis of monocultured dermal fibroblasts and keratinocytes revealed that only fibroblasts but not keratinocytes displayed up regulated CXCL5 levels after UV stimulation.
25689618 This study aims to evaluate serum levels of ENA78/CXCL5 and SDF-1/CXCL12 along the gastric cancer carcinogenesis, and analyze their clinical significance, and diagnostic potentials through human serum samples.
25536401 the increased level of CXCL5 in tissue compartments, including the central nervous system of HIV-1-infected individuals might alter the inflammatory response through the infiltration of neutrophils into tissue compartment
25462858 our data showed that the CXCR2/CXCL5 axis contributes to EMT of HCC cells through activating PI3K/Akt/GSK-3beta/Snail signaling, and it may serve as a potential therapeutic target.
25011526 data indicates that LCCs per se may act as the producer and receptor of CXCL5 responsible for liver cancer migration and invasion
More...

AA Sequence

MSLLSSRAARVPGPSSSLCALLVLLLLLTQPGPIASAGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFA      1 - 70
IGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN                               71 - 114
//

Text Mined References (100)

PMID Year Title
26287498 2015 CXCL5 is associated with the increased risk of coronary artery disease.
26058729 2015 CXCL5/CXCR2 axis promotes bladder cancer cell migration and invasion by activating PI3K/AKT-induced upregulation of MMP2/MMP9.
25871636 2015 The possible link between elevated serum levels of epithelial cell-derived neutrophil-activating peptide-78 (ENA-78/CXCL5) and autoimmunity in autistic children.
25788272 2015 DACH1 inhibits lung adenocarcinoma invasion and tumor growth by repressing CXCL5 signaling.
25738378 2015 A microRNA signature in pediatric ulcerative colitis: deregulation of the miR-4284/CXCL5 pathway in the intestinal epithelium.
25690483 2015 UV radiation induces CXCL5 expression in human skin.
25689618 2015 Serum ENA78/CXCL5, SDF-1/CXCL12, and their combinations as potential biomarkers for prediction of the presence and distant metastasis of primary gastric cancer.
25536401 2015 Transcriptional Regulation of CXCL5 in HIV-1-Infected Macrophages and Its Functional Consequences on CNS Pathology.
25462858 2015 CXCR2/CXCL5 axis contributes to epithelial-mesenchymal transition of HCC cells through activating PI3K/Akt/GSK-3?/Snail signaling.
25011526 2014 Roles of CXCL5 on migration and invasion of liver cancer cells.
More...