Property Summary

NCBI Gene PubMed Count 108
PubMed Score 266.42
PubTator Score 188.67

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
Pneumonia -1.200 4.3e-02
active Crohn's disease 3.979 3.5e-02
Breast cancer -1.300 1.6e-04
chronic rhinosinusitis 2.498 1.6e-02
colon cancer 3.400 2.7e-02
cystic fibrosis 3.850 5.5e-06
ependymoma 3.900 7.1e-07
gastric cancer 1.900 1.1e-02
hepatocellular carcinoma 1.500 5.2e-03
interstitial cystitis 3.500 2.5e-02
intraductal papillary-mucinous adenoma (... 2.700 3.2e-02
intraductal papillary-mucinous neoplasm ... 5.700 1.3e-03
lung cancer -2.500 1.4e-04
malignant mesothelioma -6.800 5.2e-10
medulloblastoma -1.200 6.4e-05
medulloblastoma, large-cell -1.100 1.7e-03
non primary Sjogren syndrome sicca -1.200 1.6e-02
non-small cell lung cancer -1.476 7.0e-04
pancreatic cancer 2.300 4.8e-03
pancreatic carcinoma 2.300 4.8e-03
psoriasis 4.200 1.3e-45
tuberculosis -3.800 7.7e-06
ulcerative colitis 6.700 1.3e-09

Protein-protein Interaction (6)

Gene RIF (82)

AA Sequence

MSLLSSRAARVPGPSSSLCALLVLLLLLTQPGPIASAGPAAAVLRELRCVCLQTTQGVHPKMISNLQVFA      1 - 70
IGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN                               71 - 114
//

Text Mined References (108)

PMID Year Title