Property Summary

NCBI Gene PubMed Count 32
Grant Count 80
R01 Count 55
Funding $13,503,858.35
PubMed Score 83.04
PubTator Score 216.94

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P42785 A8MU24 B2R7B7 B3KRK5 B5BU34
Symbols PCP
HUMPCP

Gene

PANTHER Protein Class (3)

PDB

3N2Z  

Gene RIF (21)

PMID Text
25370794 The decrease in PRCP levels in the first 24 h after stroke onset is associated with stroke severity and an unfavourable short-term stroke outcome
25324000 PRCP1 interacts with plasma kallikrein (PK) at multiple sites for PK activation.
23744584 PRCP regulates cell growth, angiogenesis, and the response to vascular injury
22679278 The present results indicated PRCP rs7104980 can be considered as a marker for EH and Hap3 GAGCACTAACA (PRCP) and Hap16 TTTA (CMA1) might be associated with essential hypertension in Chinese Han population.
22079761 analysis of non-benzimidazole and brain-penetrant prolylcarboxypeptidase inhibitors
21087932 PRCP as a resistance factor for 4OHTAM resistance in estrogen receptor-positive breast cancer cells.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20540760 A structure-based alignment with the previously undescribed structure of DPP7 illuminates the mechanism of orthogonal substrate specificity of PRCP and DPP7.
20517885 A single peptide, with the sequence YPRPIHPA, as a novel substrate for PRCP in human cerebrospinal fluid.
20516604 Purified PrCP yielded crystals belonging to space group R32, with unit-cell parameters a = b = 181.14, c = 240.13 A, that diffracted to better than 2.8 A resolution.
More...

AA Sequence

MGRRALLLLLLSFLAPWATIALRPALRALGSLHLPTNPTSLPAVAKNYSVLYFQQKVDHFGFNTVKTFNQ      1 - 70
RYLVADKYWKKNGGSILFYTGNEGDIIWFCNNTGFMWDVAEELKAMLVFAEHRYYGESLPFGDNSFKDSR     71 - 140
HLNFLTSEQALADFAELIKHLKRTIPGAENQPVIAIGGSYGGMLAAWFRMKYPHMVVGALAASAPIWQFE    141 - 210
DLVPCGVFMKIVTTDFRKSGPHCSESIHRSWDAINRLSNTGSGLQWLTGALHLCSPLTSQDIQHLKDWIS    211 - 280
ETWVNLAMVDYPYASNFLQPLPAWPIKVVCQYLKNPNVSDSLLLQNIFQALNVYYNYSGQVKCLNISETA    281 - 350
TSSLGTLGWSYQACTEVVMPFCTNGVDDMFEPHSWNLKELSDDCFQQWGVRPRPSWITTMYGGKNISSHT    351 - 420
NIVFSNGELDPWSGGGVTKDITDTLVAVTISEGAHHLDLRTKNALDPMSVLLARSLEVRHMKNWIRDFYD    421 - 490
SAGKQH                                                                    491 - 496
//

Text Mined References (38)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25370794 2015 Prolyl carboxypeptidase activity decline correlates with severity and short-term outcome in acute ischemic stroke.
25324000 2014 Prolylcarboxypeptidase independently activates plasma prekallikrein (fletcher factor).
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23744584 2013 Prolylcarboxypeptidase promotes angiogenesis and vascular repair.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22679278 2013 Association of polymorphisms in prolylcarboxypeptidase and chymase genes with essential hypertension in the Chinese Han population.
22079761 2012 The discovery of non-benzimidazole and brain-penetrant prolylcarboxypeptidase inhibitors.
21269460 2011 Initial characterization of the human central proteome.
More...