Property Summary

NCBI Gene PubMed Count 348
Grant Count 86
R01 Count 52
Funding $10,703,674.4
PubMed Score 404.86
PubTator Score 972.00

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P42772 O15125 Q6FI09
Symbols P15
MTS2
TP15
CDK4I
INK4B
p15INK4b

Gene

Gene RIF (303)

PMID Text
27090891 Data indicate that Philadelphia chromosome-positive (Ph-positive) acute lymphoblastic leukemia (ALL) patients who presented with cyclin dependent kinase inhibitor 2A/B (CDKN2A/B) deletion showed a higher rate of CD20 antigen expression.
27060304 High expression of p15 antisense RNA is associated with acute myeloid leukemia.
27049325 Risk alleles for 6 loci increased glucose levels from birth to 5 years of age (ADCY5, ADRA2A, CDKAL1, CDKN2A/B, GRB10, and TCF7L2
26911146 Data show that KDM5B is frequently up-regulated in hepatocellular carcinoma tissues and cell lines and correlated with poor prognosis. Its depletion leads to highly impaired clonogenesis and cell cycle arrest through up-regulation of p15 and p27.
26868379 CDKN2B variants are associated with pediatric B-cell precursor acute lymphoblastic leukemia.
26782424 Inhibited HO-1 expression attenuated the hypermethylation of CDKN2B by suppressing DNMT1, which was conducive to treatment by cooperating with decitabine.
26596284 Loss of CDKN2B may not only promote cardiovascular disease through the development of atherosclerosis but may also impair TGFbeta signaling and hypoxic neovessel maturation.
26577493 The CDKN2A/CDKN2B rs4977756 polymorphism increases the risk of developing glioma in Caucasians. (Meta-analysis)
26501552 Children with ALL have higher levels of p15 CpG island methylation than a control group of children with ITP.
26470845 Tumor suppressor ASXL1 is essential for the activation of INK4B expression in response to oncogene activity and anti-proliferative signals
More...

AA Sequence

MREENKGMPSGGGSDEGLASAAARGLVEKVRQLLEAGADPNGVNRFGRRAIQVMMMGSARVAELLLLHGA      1 - 70
EPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEERGHRDVAGYLRTATGD       71 - 138
//

Text Mined References (348)

PMID Year Title
27090891 2016 Correlation between deletion of the CDKN2 gene and tyrosine kinase inhibitor resistance in adult Philadelphia chromosome-positive acute lymphoblastic leukemia.
27060304 2016 [High expression of p15 antisense RNA is a frequent event in acute myeloid leukemia].
27049325 2016 Risk Alleles in/near ADCY5, ADRA2A, CDKAL1, CDKN2A/B, GRB10, and TCF7L2 Elevate Plasma Glucose Levels at Birth and in Early Childhood: Results from the FAMILY Study.
26911146 2016 Depletion of histone demethylase KDM5B inhibits cell proliferation of hepatocellular carcinoma by regulation of cell cycle checkpoint proteins p15 and p27.
26868379 2016 A variant at 9p21.3 functionally implicates CDKN2B in paediatric B-cell precursor acute lymphoblastic leukaemia aetiology.
26782424 2015 Role of heme oxygenase-1 in demethylating effects on SKM-1 cells induced by decitabine.
26596284 2016 CDKN2B Regulates TGF? Signaling and Smooth Muscle Cell Investment of Hypoxic Neovessels.
26577493 2016 Effect of CDKN2A/B rs4977756 polymorphism on glioma risk: a meta-analysis of 16 studies including 24077 participants.
26501552 2016 Hypermethylation of p15 gene associated with an inferior poor long-term outcome in childhood acute lymphoblastic leukemia.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
More...