Property Summary

NCBI Gene PubMed Count 374
PubMed Score 428.82
PubTator Score 972.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Glaucoma 239 3.49 1.7
Brain cancer 30 0.0 1.5
Malignant glioma 26 0.0 1.5
Disease Target Count Z-score Confidence
Cancer 2499 5.348 2.7

Expression

  Differential Expression (24)

Disease log2 FC p
active ulcerative colitis -1.325 2.2e-02
acute quadriplegic myopathy 1.519 2.8e-06
adult high grade glioma 2.300 4.5e-05
Amyotrophic lateral sclerosis 1.011 2.2e-08
astrocytic glioma 1.300 5.1e-03
Astrocytoma, Pilocytic 3.000 5.4e-06
atypical teratoid / rhabdoid tumor 2.000 3.8e-03
Breast cancer 1.600 1.1e-05
cystic fibrosis -1.806 3.8e-05
ductal carcinoma in situ -1.500 2.4e-02
glioblastoma 1.600 1.3e-02
hepatocellular carcinoma 1.100 5.7e-04
intraductal papillary-mucinous adenoma (... 2.000 1.4e-02
invasive ductal carcinoma 1.160 8.6e-03
nasopharyngeal carcinoma -1.100 2.8e-02
non-small cell lung cancer -1.794 1.9e-11
oligodendroglioma 1.300 1.3e-05
ovarian cancer 1.800 4.5e-03
pancreatic cancer 1.500 5.3e-03
pituitary cancer -2.400 1.3e-06
primary pancreatic ductal adenocarcinoma 1.365 1.3e-02
spina bifida -2.698 4.1e-02
subependymal giant cell astrocytoma 1.636 1.3e-02
tuberculosis and treatment for 3 months -1.100 4.5e-04

Synonym

Accession P42772 O15125 Q6FI09
Symbols P15
MTS2
TP15
CDK4I
INK4B
p15INK4b

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

Protein-protein Interaction (2)

Gene RIF (328)

AA Sequence

MREENKGMPSGGGSDEGLASAAARGLVEKVRQLLEAGADPNGVNRFGRRAIQVMMMGSARVAELLLLHGA      1 - 70
EPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEERGHRDVAGYLRTATGD       71 - 138
//

Text Mined References (374)

PMID Year Title