Property Summary

NCBI Gene PubMed Count 1,886
PubMed Score 8561.27
PubTator Score 6186.48

Knowledge Summary

Patent

No data available

Synonym

Accession P42771 A5X2G7 D3DRK1 O95440 Q15191 Q5VVJ5 Q96B52 Q9NP05
Symbols ARF
MLM
P14
P16
P19
CMM2
INK4
MTS1
TP16
CDK4I
CDKN2
INK4A
MTS-1
P14ARF
P19ARF
P16INK4
P16INK4A
P16-INK4A

Gene

PDB

1A5E   1BI7   1DC2   2A5E  

Gene RIF (1844)

PMID Text
27468574 The circulating auto-antibody to P16 may be one of a series of potential biomarkers with early prognostic values for cervical cancer.
27363060 the current study supported the critical function of p16 and ki-67 as a speciphic markers for accurate diagnosis of cervical intraepithelial carcinoma
27333655 significantly higher percentage (86.0 +/- 14.1%) of tryptase-positive tumor cells was immunoreactive to p16(INK4a) in all of 4 mastocytosis
27159948 conclude that the p16INK4a expression is not a good marker for dictating malignant transformation of sweat gland tumors
27126662 Suggest role for p16INK4a in subcategorizing equivocal and early premalignant cervical squamous lesions in which HPV is detected.
27090891 Data indicate that Philadelphia chromosome-positive (Ph-positive) acute lymphoblastic leukemia (ALL) patients who presented with cyclin dependent kinase inhibitor 2A/B (CDKN2A/B) deletion showed a higher rate of CD20 antigen expression.
27049325 Risk alleles for 6 loci increased glucose levels from birth to 5 years of age (ADCY5, ADRA2A, CDKAL1, CDKN2A/B, GRB10, and TCF7L2
27029014 p16ink4a expression in human LSGs may constitute a potential peripheral correlate of cognitive decline
26999279 p14ARF gene methylation may be significantly associated with tumor location, and microsatellite instability status of colorectal cancer.
26997452 p16 expression predicts postchemotherapy necrotic response in conventional osteosarcomas.
More...

AA Sequence

MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEP      1 - 70
NCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGS     71 - 140
NHARIDAAEGPSDIPD                                                          141 - 156
//

Text Mined References (1893)

PMID Year Title
27468574 2016 Detecting of p16 Autoantibody as a Potential Early Diagnostic Serum Biomarker in Patients with Cervical Cancer.
27363060 2016 Value of p16(INK4a) and Ki-67 Immunohistochemical Staining in Cervical Intraepithelial Neoplasia Grade 2 Biopsies as Biomarkers for Cervical Intraepithelial Neoplasia Grade 3 in Cone Results.
27333655 2016 Overexpression of p16(INK4a) in Mastocytosis (Urticarial Pigmentosa).
27159948 2015 Immunohistological Expression of p16INK4a is Commonly Present Both in Benign and Malignant Sweat Gland Neoplasias.
27126662 2016 Correlation of p16INK4a immunoexpression and human papillomavirus (HPV) detected by in-situ hybridization in cervical squamous neoplasia.
27090891 2016 Correlation between deletion of the CDKN2 gene and tyrosine kinase inhibitor resistance in adult Philadelphia chromosome-positive acute lymphoblastic leukemia.
27049325 2016 Risk Alleles in/near ADCY5, ADRA2A, CDKAL1, CDKN2A/B, GRB10, and TCF7L2 Elevate Plasma Glucose Levels at Birth and in Early Childhood: Results from the FAMILY Study.
27029014 2016 Elevated p16ink4a Expression in Human Labial Salivary Glands as a Potential Correlate of Cognitive Aging in Late Midlife.
26999279 2016 Relationships between p14ARF Gene Methylation and Clinicopathological Features of Colorectal Cancer: A Meta-Analysis.
26997452 2016 p16 expression predicts neoadjuvant tumor necrosis in osteosarcomas: reappraisal with a larger series using whole sections.
More...