Property Summary

NCBI Gene PubMed Count 2,031
PubMed Score 9058.64
PubTator Score 6186.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Lymphoid leukemia 160 0.0 2.6
Disease Target Count Z-score Confidence
Head and neck squamous cell carcinoma 11 0.0 5.0
lung cancer 4740 0.0 1.5
Disease Target Count Z-score Confidence
Cancer 2499 7.491 3.7
Li-Fraumeni syndrome 13 0.0 4.0

Protein-protein Interaction (2)

Gene RIF (1988)

AA Sequence

MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEP      1 - 70
NCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGS     71 - 140
NHARIDAAEGPSDIPD                                                          141 - 156
//

Text Mined References (2038)

PMID Year Title