Property Summary

NCBI Gene PubMed Count 17
PubMed Score 19.37
PubTator Score 74.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Expression

Synonym

Accession P42766 A8K4V7 Q4VBY5 Q5JTN5 Q6IBC7 Q96QJ7 Q9BYF4
Symbols L35

Gene

PDB

4UG0   4V6X   5AJ0  

  Ortholog (13)

Gene RIF (3)

PMID Text
26362536 HIV-1 Gag interacts with RPL35 as demonstrated by proximity dependent biotinylation proteomics
22944692 HIV-1 Gag interacts with RPL35 as demonstrated by proximity dependent biotinylation proteomics
18523488 The eukaryotic expansion segment at the C-terminal end of human ribosomal protein L35 was essential for the nuclear import of L35.

AA Sequence

MAKIKARDLRGKKKEELLKQLDDLKVELSQLRVAKVTGGAASKLSKIRVVRKSIARVLTVINQTQKENLR      1 - 70
KFYKGKKYKPLDLRPKKTRAMRRRLNKHEENLKTKKQQRKERLYPLRKYAVKA                      71 - 123
//

Text Mined References (24)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
19946888 2010 Defining the membrane proteome of NK cells.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18523488 2008 The role of expansion segment of human ribosomal protein L35 in nuclear entry, translation activity, and endoplasmic reticulum docking.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
More...