Property Summary

NCBI Gene PubMed Count 17
PubMed Score 19.14
PubTator Score 74.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Gene RIF (3)

AA Sequence

MAKIKARDLRGKKKEELLKQLDDLKVELSQLRVAKVTGGAASKLSKIRVVRKSIARVLTVINQTQKENLR      1 - 70
KFYKGKKYKPLDLRPKKTRAMRRRLNKHEENLKTKKQQRKERLYPLRKYAVKA                      71 - 123
//

Text Mined References (26)

PMID Year Title