Property Summary

NCBI Gene PubMed Count 17
PubMed Score 19.37
PubTator Score 74.13

Knowledge Summary

Patent

No data available

Expression

Gene RIF (3)

PMID Text
26362536 HIV-1 Gag interacts with RPL35 as demonstrated by proximity dependent biotinylation proteomics
22944692 HIV-1 Gag interacts with RPL35 as demonstrated by proximity dependent biotinylation proteomics
18523488 The eukaryotic expansion segment at the C-terminal end of human ribosomal protein L35 was essential for the nuclear import of L35.

AA Sequence

MAKIKARDLRGKKKEELLKQLDDLKVELSQLRVAKVTGGAASKLSKIRVVRKSIARVLTVINQTQKENLR      1 - 70
KFYKGKKYKPLDLRPKKTRAMRRRLNKHEENLKTKKQQRKERLYPLRKYAVKA                      71 - 123
//

Text Mined References (24)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
19946888 2010 Defining the membrane proteome of NK cells.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
18523488 2008 The role of expansion segment of human ribosomal protein L35 in nuclear entry, translation activity, and endoplasmic reticulum docking.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
More...