Property Summary

NCBI Gene PubMed Count 16
PubMed Score 59.66
PubTator Score 8.87

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
adult high grade glioma -1.200 3.9e-04
astrocytoma -1.100 1.8e-02
lung adenocarcinoma -1.600 6.1e-11
non-inflammatory breast cancer -1.200 4.0e-04
osteosarcoma -1.516 2.4e-05

 GWAS Trait (1)

Protein-protein Interaction (2)

Gene RIF (6)

AA Sequence

MALLRGVFVVAAKRTPFGAYGGLLKDFTATDLSEFAAKAALSAGKVSPETVDSVIMGNVLQSSSDAIYLA      1 - 70
RHVGLRVGIPKETPALTINRLCGSGFQSIVNGCQEICVKEAEVVLCGGTESMSQAPYCVRNVRFGTKLGS     71 - 140
DIKLEDSLWVSLTDQHVQLPMAMTAENLAVKHKISREECDKYALQSQQRWKAANDAGYFNDEMAPIEVKT    141 - 210
KKGKQTMQVDEHARPQTTLEQLQKLPPVFKKDGTVTAGNASGVADGAGAVIIASEDAVKKHNFTPLARIV    211 - 280
GYFVSGCDPSIMGIGPVPAISGALKKAGLSLKDMDLVEVNEAFAPQYLAVERSLDLDISKTNVNGGAIAL    281 - 350
GHPLGGSGSRITAHLVHELRRRGGKYAVGSACIGGGQGIAVIIQSTA                           351 - 397
//

Text Mined References (20)

PMID Year Title