Property Summary

NCBI Gene PubMed Count 56
PubMed Score 54.11
PubTator Score 41.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Leigh syndrome , French Canadian type 2 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
cytochrome-c oxidase deficiency disease 19 0.0 5.0
Disease Target Count Z-score Confidence
Leigh disease 100 6.067 3.0

Expression

  Differential Expression (18)

Disease log2 FC p
astrocytic glioma 1.600 6.0e-03
atypical teratoid / rhabdoid tumor -1.200 1.2e-05
ependymoma 1.800 1.3e-02
glioblastoma -1.400 1.0e-04
group 3 medulloblastoma 1.300 4.0e-02
hereditary spastic paraplegia -1.129 7.8e-03
intraductal papillary-mucinous carcinoma... 1.100 3.2e-02
intraductal papillary-mucinous neoplasm ... 1.300 2.4e-02
lung cancer 1.600 1.1e-02
medulloblastoma, large-cell 1.200 1.4e-03
Multiple myeloma 1.373 1.0e-03
non-small cell lung cancer 1.009 1.6e-17
oligodendroglioma 2.000 2.2e-03
osteosarcoma 1.001 3.6e-03
ovarian cancer -1.800 1.4e-05
Pick disease -1.200 5.5e-04
tuberculosis and treatment for 6 months 1.100 2.2e-04
Waldenstrons macroglobulinemia 1.440 1.7e-02

Gene RIF (34)

AA Sequence

MAALLRSARWLLRAGAAPRLPLSLRLLPGGPGRLHAASYLPAARAGPVAGGLLSPARLYAIAAKEKDIQE      1 - 70
ESTFSSRKISNQFDWALMRLDLSVRRTGRIPKKLLQKVFNDTCRSGGLGGSHALLLLRSCGSLLPELKLE     71 - 140
ERTEFAHRIWDTLQKLGAVYDVSHYNALLKVYLQNEYKFSPTDFLAKMEEANIQPNRVTYQRLIASYCNV    141 - 210
GDIEGASKILGFMKTKDLPVTEAVFSALVTGHARAGDMENAENILTVMRDAGIEPGPDTYLALLNAYAEK    211 - 280
GDIDHVKQTLEKVEKSELHLMDRDLLQIIFSFSKAGYPQYVSEILEKVTCERRYIPDAMNLILLLVTEKL    281 - 350
EDVALQILLACPVSKEDGPSVFGSFFLQHCVTMNTPVEKLTDYCKKLKEVQMHSFPLQFTLHCALLANKT    351 - 420
DLAKALMKAVKEEGFPIRPHYFWPLLVGRRKEKNVQGIIEILKGMQELGVHPDQETYTDYVIPCFDSVNS    421 - 490
ARAILQENGCLSDSDMFSQAGLRSEAANGNLDFVLSFLKSNTLPISLQSIRSSLLLGFRRSMNINLWSEI    491 - 560
TELLYKDGRYCQEPRGPTEAVGYFLYNLIDSMSDSEVQAKEEHLRQYFHQLEKMNVKIPENIYRGIRNLL    561 - 630
ESYHVPELIKDAHLLVESKNLDFQKTVQLTSSELESTLETLKAENQPIRDVLKQLILVLCSEENMQKALE    631 - 700
LKAKYESDMVTGGYAALINLCCRHDKVEDALNLKEEFDRLDSSAVLDTGKYVGLVRVLAKHGKLQDAINI    701 - 770
LKEMKEKDVLIKDTTALSFFHMLNGAALRGEIETVKQLHEAIVTLGLAEPSTNISFPLVTVHLEKGDLST    771 - 840
ALEVAIDCYEKYKVLPRIHDVLCKLVEKGETDLIQKAMDFVSQEQGEMVMLYDLFFAFLQTGNYKEAKKI    841 - 910
IETPGIRARSARLQWFCDRCVANNQVETLEKLVELTQKLFECDRDQMYYNLLKLYKINGDWQRADAVWNK    911 - 980
IQEENVIPREKTLRLLAEILREGNQEVPFDVPELWYEDEKHSLNSSSASTTEPDFQKDILIACRLNQKKG    981 - 1050
AYDIFLNAKEQNIVFNAETYSNLIKLLMSEDYFTQAMEVKAFAETHIKGFTLNDAANSRLIITQVRRDYL   1051 - 1120
KEAVTTLKTVLDQQQTPSRLAVTRVIQALAMKGDVENIEVVQKMLNGLEDSIGLSKMVFINNIALAQIKN   1121 - 1190
NNIDAAIENIENMLTSENKVIEPQYFGLAYLFRKVIEEQLEPAVEKISIMAERLANQFAIYKPVTDFFLQ   1191 - 1260
LVDAGKVDDARALLQRCGAIAEQTPILLLFLLRNSRKQGKASTVKSVLELIPELNEKEEAYNSLMKSYVS   1261 - 1330
EKDVTSAKALYEHLTAKNTKLDDLFLKRYASLLKYAGEPVPFIEPPESFEFYAQQLRKLRENSS         1331 - 1394
//

Text Mined References (66)

PMID Year Title