Property Summary

NCBI Gene PubMed Count 69
PubMed Score 212.16
PubTator Score 110.16

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (6)

Disease Target Count P-value
breast carcinoma 1614 1.087579454516E-43
lung adenocarcinoma 2714 1.72293470145677E-25
non-small cell lung cancer 2798 9.25948872434599E-17
astrocytoma 1493 1.03179536888282E-9
malignant mesothelioma 3163 1.05548255351194E-8
psoriasis 6685 1.4188338337043E-8
lung carcinoma 2844 5.07165532292252E-8
lung cancer 4473 2.73951732382211E-7
colon cancer 1475 1.42766566364565E-6
Pick disease 1893 1.26741238734928E-5
medulloblastoma, large-cell 6234 1.50703774033493E-5
ovarian cancer 8492 7.550130072907E-5
ductal carcinoma in situ 1745 1.0136317647608E-4
invasive ductal carcinoma 2950 3.16497055400314E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 4.19558761057236E-4
pancreatic cancer 2300 4.6675658988529E-4
osteosarcoma 7933 7.20762473576801E-4
adrenocortical carcinoma 1427 0.00752608811667635
group 3 medulloblastoma 2254 0.00967919177772112
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00969688948850281
glioblastoma 5572 0.0105627838882397
pituitary cancer 1972 0.0105939500317016
ependymoma 2514 0.0106672836043529
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0119710283506312
progressive supranuclear palsy 674 0.0158824457048107
Breast cancer 3099 0.0215510499526643
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0256229337774608
gastric carcinoma 832 0.0310104024067986
oligodendroglioma 2849 0.0375433208804147
atypical teratoid/rhabdoid tumor 1095 0.0385184750951677
Hydrolethalus syndrome 128 0.0458599866984329
interstitial lung disease 292 0.0462799431809957
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
cold-induced sweating syndrome 6 5.146 2.6
Leukocoria 7 3.024 1.5
Disease Target Count
STUVE-WIEDEMANN SYNDROME 1
Disease Target Count
Stueve-Wiedemann syndrome 1

Expression

  Differential Expression (32)

Synonym

Accession P42702 Q6LCD9 LIF receptor
Symbols SWS
SJS2
STWS
CD118
LIF-R

Gene

PDB

3E0G  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (38)

PMID Text
26329521 High LIFr expression stimulates melanoma cell migration and is associated with unfavorable prognosis in melanoma.
26285796 The C65S mutant LIFR showed altered glycosylation and an elevated expression level that might be attributed to a slow turnover of the mutant form.
26249360 these findings conclude that LIFR functions as a novel metastasis suppressor in Hepatocellular carcinoma and may serve as a prognostic biomarker for Hepatocellular carcinoma patients.
25790555 Studied the association of tubal pregnancy with leukemia inhibitory factor (LIF) and leukemia inhibitory factor receptor (LIFR) expression in oviduct tissues.
25749520 LIFR may play a functional role in hepatocarcinogenesis
25514345 Expression of the LIF receptor was strongly increased on immune cells of multiple sclerosis patients.
25145448 Stuve-Wiedemann syndrome patients with (p.Arg692X) LIFR mutation may develop central adrenal insufficiency due to impaired LIF/LIFR signalling. LIF/LIFR system plays a role in human HPA axis regulation.
25092123 The LIFRalpha-CT3 TAT fusion protein can inhibit miR-155 expression
24802752 R28E mutation in CNTF abrogatesIL-6 receptor-dependent but retains CNTF receptor-dependent signaling via glycoprotein 130/ LIFR.
24618404 LIFR signaling usually follows the JAK/STAT3 pathway, and is initiated by several interleukin-6-type cytokines
More...

AA Sequence

MMDIYVCLKRPSWMVDNKRMRTASNFQWLLSTFILLYLMNQVNSQKKGAPHDLKCVTNNLQVWNCSWKAP      1 - 70
SGTGRGTDYEVCIENRSRSCYQLEKTSIKIPALSHGDYEITINSLHDFGSSTSKFTLNEQNVSLIPDTPE     71 - 140
ILNLSADFSTSTLYLKWNDRGSVFPHRSNVIWEIKVLRKESMELVKLVTHNTTLNGKDTLHHWSWASDMP    141 - 210
LECAIHFVEIRCYIDNLHFSGLEEWSDWSPVKNISWIPDSQTKVFPQDKVILVGSDITFCCVSQEKVLSA    211 - 280
LIGHTNCPLIHLDGENVAIKIRNISVSASSGTNVVFTTEDNIFGTVIFAGYPPDTPQQLNCETHDLKEII    281 - 350
CSWNPGRVTALVGPRATSYTLVESFSGKYVRLKRAEAPTNESYQLLFQMLPNQEIYNFTLNAHNPLGRSQ    351 - 420
STILVNITEKVYPHTPTSFKVKDINSTAVKLSWHLPGNFAKINFLCEIEIKKSNSVQEQRNVTIKGVENS    421 - 490
SYLVALDKLNPYTLYTFRIRCSTETFWKWSKWSNKKQHLTTEASPSKGPDTWREWSSDGKNLIIYWKPLP    491 - 560
INEANGKILSYNVSCSSDEETQSLSEIPDPQHKAEIRLDKNDYIISVVAKNSVGSSPPSKIASMEIPNDD    561 - 630
LKIEQVVGMGKGILLTWHYDPNMTCDYVIKWCNSSRSEPCLMDWRKVPSNSTETVIESDEFRPGIRYNFF    631 - 700
LYGCRNQGYQLLRSMIGYIEELAPIVAPNFTVEDTSADSILVKWEDIPVEELRGFLRGYLFYFGKGERDT    701 - 770
SKMRVLESGRSDIKVKNITDISQKTLRIADLQGKTSYHLVLRAYTDGGVGPEKSMYVVTKENSVGLIIAI    771 - 840
LIPVAVAVIVGVVTSILCYRKREWIKETFYPDIPNPENCKALQFQKSVCEGSSALKTLEMNPCTPNNVEV    841 - 910
LETRSAFPKIEDTEIISPVAERPEDRSDAEPENHVVVSYCPPIIEEEIPNPAADEAGGTAQVIYIDVQSM    911 - 980
YQPQAKPEEEQENDPVGGAGYKPQMHLPINSTVEDIAAEEDLDKTAGYRPQANVNTWNLVSPDSPRSIDS    981 - 1050
NSEIVSFGSPCSINSRQFLIPPKDEDSPKSNGGGWSFTNFFQNKPND                          1051 - 1097
//

Text Mined References (71)

PMID Year Title
26329521 2015 High LIFr expression stimulates melanoma cell migration and is associated with unfavorable prognosis in melanoma.
26285796 2016 Non-truncating LIFR mutation: causal for prominent congenital pain insensitivity phenotype with progressive vertebral destruction?
26249360 2015 LIFR functions as a metastasis suppressor in hepatocellular carcinoma by negatively regulating phosphoinositide 3-kinase/AKT pathway.
25790555 2015 Aberrant expression of leukemia inhibitory factor receptor (LIFR) and leukemia inhibitory factor (LIF) is associated with tubal pregnancy occurrence.
25749520 2015 Leukemia inhibitory factor receptor is a novel immunomarker in distinction of well-differentiated HCC from dysplastic nodules.
25514345 2015 Leukemia inhibitory factor tips the immune balance towards regulatory T cells in multiple sclerosis.
25145448 2015 Effects of leukemia inhibitory receptor gene mutations on human hypothalamo-pituitary-adrenal function.
25092123 2014 LIFR?-CT3 induces differentiation of a human acute myelogenous leukemia cell line HL-60 by suppressing miR-155 expression through the JAK/STAT pathway.
24802752 2014 The amino acid exchange R28E in ciliary neurotrophic factor (CNTF) abrogates interleukin-6 receptor-dependent but retains CNTF receptor-dependent signaling via glycoprotein 130 (gp130)/leukemia inhibitory factor receptor (LIFR).
24618404 2014 Stüve-Wiedemann syndrome: LIFR and associated cytokines in clinical course and etiology.
More...