Property Summary

NCBI Gene PubMed Count 100
PubMed Score 220.95
PubTator Score 132.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (7)

Disease log2 FC p
tuberculosis 1.100 5.1e-07
active Crohn's disease 1.923 6.3e-03
active ulcerative colitis 1.458 3.4e-02
interstitial cystitis 1.700 3.0e-03
non-small cell lung cancer -1.080 1.3e-13
osteosarcoma -2.884 2.5e-08
psoriasis 1.600 9.8e-70

 GWAS Trait (1)

Gene RIF (90)

AA Sequence

MEPLVTWVVPLLFLFLLSRQGAACRTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPT      1 - 70
AGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWARNQTEKSPEVTLQLYNSVKYE     71 - 140
PPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSPWKLGDCGPQDDDTESCLCPLEMNVAQEFQL    141 - 210
RRRQLGSQGSSWSKWSSPVCVPPENPPQPQVRFSVEQLGQDGRRRLTLKEQPTQLELPEGCQGLAPGTEV    211 - 280
TYRLQLHMLSCPCKAKATRTLHLGKMPYLSGAAYNVAVISSNQFGPGLNQTWHIPADTHTEPVALNISVG    281 - 350
TNGTTMYWPARAQSMTYCIEWQPVGQDGGLATCSLTAPQDPDPAGMATYSWSRESGAMGQEKCYYITIFA    351 - 420
SAHPEKLTLWSTVLSTYHFGGNASAAGTPHHVSVKNHSLDSVSVDWAPSLLSTCPGVLKEYVVRCRDEDS    421 - 490
KQVSEHPVQPTETQVTLSGLRAGVAYTVQVRADTAWLRGVWSQPQRFSIEVQVSDWLIFFASLGSFLSIL    491 - 560
LVGVLGYLGLNRAARHLCPPLPTPCASSAIEFPGGKETWQWINPVDFQEEASLQEALVVEMSWDKGERTE    561 - 630
PLEKTELPEGAPELALDTELSLEDGDRCKAKM                                          631 - 662
//

Text Mined References (103)

PMID Year Title