Property Summary

NCBI Gene PubMed Count 96
Grant Count 74
R01 Count 52
Funding $8,532,800.8
PubMed Score 207.06
PubTator Score 132.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma -2.884 0.000
tuberculosis 1.100 0.000
non-small cell lung cancer -1.080 0.000
active Crohn's disease 1.923 0.006
ulcerative colitis 1.500 0.000
interstitial cystitis 1.700 0.003
psoriasis 1.600 0.000

Synonym

Accession P42701 A8K308 B2RPF1 B7ZKK3 Q8N6Q7 IL-12 receptor subunit beta-1
Symbols CD212
IMD30
IL12RB
IL-12R-BETA1

Gene

 GO Function (1)

Gene RIF (86)

PMID Text
26621740 the introduction of RNA-DNA differences into an individual's IL12RB1 mRNA repertoire is a novel determinant of IL12/23 sensitivity.
26384304 Truncated IL12rbeta1/Fc is a novel fusion protein for specific binding multiple forms of p40 subunit to exert potent anti-inflammatory effects.
25603847 Early coupled up-regulation of IL12RB1 in CD8+ central memory and effector T cells result in better clinical outcomes in liver transplant recipients.
25516297 individual variability in IL12RB1 function is introduced at the epigenetic, genomic polymorphism, and mRNA splicing levels [review]
25467645 we describe cosegregation of a heterozygous germline defect in IL12RB1 and gastric cancer development in a family with IL-12Rbeta1 deficiency
25371211 The IL-23/IL-23R/IL-12Rbeta1 complex formation does not follow the classical "site I-II-III" architectural paradigm.
25199642 SNP rs2305743 in IL12RB1 was associated with systemic sclerosis.
24997981 Strong association of rs438421 in the IL-12Rbeta1 gene with Allergic rhinitis in Chinese was demonstrated . The GG genotype of rs438421 was validated as stimulus factors to AR, while the AG genotype of rs438421 was confirmed as protective factors to AR.
24859272 Genetic variations of IL-12B, IL-12Rbeta1, IL-12Rbeta2 in Behcet's disease and VKH syndrome.
24114017 IL12Rbeta1 expression is lacking on CD8+ T and natural killer (NK) cell surface in a 33-year-old patient with Mycobacterium tilburgii infection.
More...

AA Sequence

MEPLVTWVVPLLFLFLLSRQGAACRTSECCFQDPPYPDADSGSASGPRDLRCYRISSDRYECSWQYEGPT      1 - 70
AGVSHFLRCCLSSGRCCYFAAGSATRLQFSDQAGVSVLYTVTLWVESWARNQTEKSPEVTLQLYNSVKYE     71 - 140
PPLGDIKVSKLAGQLRMEWETPDNQVGAEVQFRHRTPSSPWKLGDCGPQDDDTESCLCPLEMNVAQEFQL    141 - 210
RRRQLGSQGSSWSKWSSPVCVPPENPPQPQVRFSVEQLGQDGRRRLTLKEQPTQLELPEGCQGLAPGTEV    211 - 280
TYRLQLHMLSCPCKAKATRTLHLGKMPYLSGAAYNVAVISSNQFGPGLNQTWHIPADTHTEPVALNISVG    281 - 350
TNGTTMYWPARAQSMTYCIEWQPVGQDGGLATCSLTAPQDPDPAGMATYSWSRESGAMGQEKCYYITIFA    351 - 420
SAHPEKLTLWSTVLSTYHFGGNASAAGTPHHVSVKNHSLDSVSVDWAPSLLSTCPGVLKEYVVRCRDEDS    421 - 490
KQVSEHPVQPTETQVTLSGLRAGVAYTVQVRADTAWLRGVWSQPQRFSIEVQVSDWLIFFASLGSFLSIL    491 - 560
LVGVLGYLGLNRAARHLCPPLPTPCASSAIEFPGGKETWQWINPVDFQEEASLQEALVVEMSWDKGERTE    561 - 630
PLEKTELPEGAPELALDTELSLEDGDRCKAKM                                          631 - 662
//

Text Mined References (99)

PMID Year Title
26621740 2015 The introduction of RNA-DNA differences underlies interindividual variation in the human IL12RB1 mRNA repertoire.
26384304 2015 A novel human truncated IL12r?1-Fc fusion protein ameliorates experimental autoimmune encephalomyelitis via specific binding of p40 to inhibit Th1 and Th17 cell differentiation.
25603847 2015 Early coupled up-regulation of interleukin-12 receptor beta-1 in CD8+ central memory and effector T cells for better clinical outcomes in liver transplant recipients.
25516297 2015 IL12R?1: the cytokine receptor that we used to know.
25467645 2015 Gastric cancer in three relatives of a patient with a biallelic IL12RB1 mutation.
25371211 2015 Non-canonical interleukin 23 receptor complex assembly: p40 protein recruits interleukin 12 receptor ?1 via site II and induces p19/interleukin 23 receptor interaction via site III.
25199642 2014 Identification of IL12RB1 as a novel systemic sclerosis susceptibility locus.
24997981 2015 Association study between interleukin-12 receptor ?1/?2 genes and allergic rhinitis in the Chinese Han population.
24859272 2014 Genetic variations of IL-12B, IL-12R?1, IL-12R?2 in Behcet's disease and VKH syndrome.
24114017 2013 IL-12R?1 deficiency and disseminated Mycobacterium tilburgii disease.
More...