Property Summary

NCBI Gene PubMed Count 15
PubMed Score 0.83
PubTator Score 0.20

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
lung cancer 4740 3.4e-04
intraductal papillary-mucinous neoplasm (IPMN) 3291 1.6e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Hereditary spherocytosis type 1 23 3.982 2.0

Expression

  Differential Expression (2)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... 1.200 1.6e-03
lung cancer 2.200 3.4e-04

Gene RIF (1)

AA Sequence

MALEGMSKRKRKRSVQEGENPDDGVRGSPPEDYRLGQVASSLFRGEHHSRGGTGRLASLFSSLEPQIQPV      1 - 70
YVPVPKQTIKKTKRNEEEESTSQIERPLSQEPAKKVKAKKKHTNAEKKLADRESALASADLEEEIHQKQG     71 - 140
QKRKNSQPGVKVADRKILDDTEDTVVSQRKKIQINQEEERLKNERTVFVGNLPVTCNKKKLKSFFKEYGQ    141 - 210
IESVRFRSLIPAEGTLSKKLAAIKRKIHPDQKNINAYVVFKEESAATQALKRNGAQIADGFRIRVDLASE    211 - 280
TSSRDKRSVFVGNLPYKVEESAIEKHFLDCGSIMAVRIVRDKMTGIGKGFGYVLFENTDSVHLALKLNNS    281 - 350
ELMGRKLRVMRSVNKEKFKQQNSNPRLKNVSKPKQGLNFTSKTAEGHPKSLFIGEKAVLLKTKKKGQKKS    351 - 420
GRPKKQRKQK                                                                421 - 430
//

Text Mined References (25)

PMID Year Title