Property Summary

NCBI Gene PubMed Count 22
PubMed Score 12.84
PubTator Score 7.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
non-small cell lung cancer 2798 3.82218641900704E-18
ovarian cancer 8492 7.70976829340186E-10
malignant mesothelioma 3163 6.9392746396424E-9
lung adenocarcinoma 2714 3.4034014802853E-8
atypical teratoid / rhabdoid tumor 4369 7.30106452212952E-8
medulloblastoma, large-cell 6234 3.65010729572677E-7
glioblastoma 5572 8.28498169791782E-6
lung cancer 4473 3.48160725224342E-5
group 3 medulloblastoma 2254 2.00509195032607E-4
primitive neuroectodermal tumor 3031 0.00102885474991493
colon cancer 1475 0.0106245906782672
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma 2.700 0.000
group 3 medulloblastoma 1.500 0.000
atypical teratoid / rhabdoid tumor 1.200 0.000
glioblastoma 1.200 0.000
medulloblastoma, large-cell 2.000 0.000
primitive neuroectodermal tumor 1.100 0.001
non-small cell lung cancer 1.035 0.000
colon cancer 1.300 0.011
lung cancer 1.500 0.000
lung adenocarcinoma 1.100 0.000
ovarian cancer 1.700 0.000

Synonym

Accession P42695 A6NFS2 Q4KMQ9
Symbols CAPD3
hcp-6
CAP-D3
hHCP-6
hCAP-D3

Gene

PANTHER Protein Class (1)

  Ortholog (11)

 GWAS Trait (1)

Gene RIF (7)

PMID Text
25701737 CAP-D3 down-regulates transcription of genes that encode amino acid transporters (SLC7A5 and SLC3A2) to promote bacterial autophagy by colon epithelial cells.
22190034 HIV-1 Vpu is identified to have a physical interaction with non-SMC condensin II complex, subunit D3 (NCAPD3) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
21498573 The initial phase of chromosome condensation requires Cdk1-mediated phosphorylation of the CAP-D3 subunit of condensin II.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19915589 We show here that protein phosphatase 2A (PP2A), which interacts with condensin II but not condensin I, plays an essential role in targeting condensin II to chromosomes.
18223322 hCAP-D3 is a new biomarker for subtype-1 prostate tumors that improves prognostication.
14532007 The CAP-D3 subunit of the condensin II complex implicated in chromosome assembly and segeregation

AA Sequence

MVALRGLGSGLQPWCPLDLRLEWVDTVWELDFTETEPLDPSIEAEIIETGLAAFTKLYESLLPFATGEHG      1 - 70
SMESIWTFFIENNVSHSTLVALFYHFVQIVHKKNVSVQYREYGLHAAGLYFLLLEVPGSVANQVFHPVMF     71 - 140
DKCIQTLKKSWPQESNLNRKRKKEQPKSSQANPGRHRKRGKPPRREDIEMDEIIEEQEDENICFSARDLS    141 - 210
QIRNAIFHLLKNFLRLLPKFSLKEKPQCVQNCIEVFVSLTNFEPVLHECHVTQARALNQAKYIPELAYYG    211 - 280
LYLLCSPIHGEGDKVISCVFHQMLSVILMLEVGEGSHRAPLAVTSQVINCRNQAVQFISALVDELKESIF    281 - 350
PVVRILLQHICAKVVDKSEYRTFAAQSLVQLLSKLPCGEYAMFIAWLYKYSRSSKIPHRVFTLDVVLALL    351 - 420
ELPEREVDNTLSLEHQKFLKHKFLVQEIMFDRCLDKAPTVRSKALSSFAHCLELTVTSASESILELLINS    421 - 490
PTFSVIESHPGTLLRNSSAFSYQRQTSNRSEPSGEINIDSSGETVGSGERCVMAMLRRRIRDEKTNVRKS    491 - 560
ALQVLVSILKHCDVSGMKEDLWILQDQCRDPAVSVRKQALQSLTELLMAQPRCVQIQKAWLRGVVPVVMD    561 - 630
CESTVQEKALEFLDQLLLQNIRHHSHFHSGDDSQVLAWALLTLLTTESQELSRYLNKAFHIWSKKEKFSP    631 - 700
TFINNVISHTGTEHSAPAWMLLSKIAGSSPRLDYSRIIQSWEKISSQQNPNSNTLGHILCVIGHIAKHLP    701 - 770
KSTRDKVTDAVKCKLNGFQWSLEVISSAVDALQRLCRASAETPAEEQELLTQVCGDVLSTCEHRLSNIVL    771 - 840
KENGTGNMDEDLLVKYIFTLGDIAQLCPARVEKRIFLLIQSVLASSADADHSPSSQGSSEAPASQPPPQV    841 - 910
RGSVMPSVIRAHAIITLGKLCLQHEDLAKKSIPALVRELEVCEDVAVRNNVIIVMCDLCIRYTIMVDKYI    911 - 980
PNISMCLKDSDPFIRKQTLILLTNLLQEEFVKWKGSLFFRFVSTLIDSHPDIASFGEFCLAHLLLKRNPV    981 - 1050
MFFQHFIECIFHFNNYEKHEKYNKFPQSEREKRLFSLKGKSNKERRMKIYKFLLEHFTDEQRFNITSKIC   1051 - 1120
LSILACFADGILPLDLDASELLSDTFEVLSSKEIKLLAMRSKPDKDLLMEEDDMALANVVMQEAQKKLIS   1121 - 1190
QVQKRNFIENIIPIIISLKTVLEKNKIPALRELMHYLREVMQDYRDELKDFFAVDKQLASELEYDMKKYQ   1191 - 1260
EQLVQEQELAKHADVAGTAGGAEVAPVAQVALCLETVPVPAGQENPAMSPAVSQPCTPRASAGHVAVSSP   1261 - 1330
TPETGPLQRLLPKARPMSLSTIAILNSVKKAVESKSRHRSRSLGVLPFTLNSGSPEKTCSQVSSYSLEQE   1331 - 1400
SNGEIEHVTKRAISTPEKSISDVTFGAGVSYIGTPRTPSSAKEKIEGRSQGNDILCLSLPDKPPPQPQQW   1401 - 1470
NVRSPARNKDTPACSRRSLRKTPLKTAN                                             1471 - 1498
//

Text Mined References (32)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25701737 2015 Chromosome-associated protein D3 promotes bacterial clearance in human intestinal epithelial cells by repressing expression of amino acid transporters.
23728299 2013 The bromodomain protein Brd4 insulates chromatin from DNA damage signalling.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21498573 2011 The initial phase of chromosome condensation requires Cdk1-mediated phosphorylation of the CAP-D3 subunit of condensin II.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20622854 2010 PHF8 mediates histone H4 lysine 20 demethylation events involved in cell cycle progression.
20551165 2010 Loss of pRB causes centromere dysfunction and chromosomal instability.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...