Property Summary

NCBI Gene PubMed Count 31
PubMed Score 43.06
PubTator Score 72.25

Knowledge Summary

Patent (17,534)

Expression

Synonym

Accession P42685 B4DY49 Q13128 Q9NTR5
Symbols GTK
RAK
PTK5

Gene

FRK

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (15)

PMID Text
25783528 antagomir-1290 significantly inhibited the proliferation, clonogenicity, invasion, and migration of CD133(+) cells by targeting fyn-related Src family tyrosine kinase.
24969324 FRK over-expression promoted beta-catenin translocation to the plasma membrane, where it formed complex with N-cadherin.
24792491 our results demonstrate a combined mechanism for the anti-proliferative effects of FRK by inhibiting cyclin D1 nucleus accumulation and pRb phosphorylation in glioma cells.
24735922 exome sequencing identified recurrent somatic FRK mutations that induce constitutive kinase activity, STAT3 activation, and cell proliferation sensitive to Src inhibitors
23318459 Data indicaate that the Rak/Frk SH2 and SH3 domains collaborate to increase the Rak-EGFR interaction.
23267173 The expression levels of FRK were significantly correlated with invasiveness in both Hep3B and HepG2 tumor cell lines.
22790444 these results clearly indicate that FRK may play a protective role against the progression of glioma by suppressing cell migration and invasion
21665990 Genetic variation near FRK/COL10A1 and VEGFA are associated with advanced age-related macular degeneration.
21074287 Study searched for mutations in the FRK gene, a recently identified tumor suppressor gene, for the first time in NSCLC. Somatic FRK mutations were found at a very low frequency in NSCLCs.
20800603 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MSNICQRLWEYLEPYLPCLSTEADKSTVIENPGALCSPQSQRHGHYFVALFDYQARTAEDLSFRAGDKLQ      1 - 70
VLDTLHEGWWFARHLEKRRDGSSQQLQGYIPSNYVAEDRSLQAEPWFFGAIGRSDAEKQLLYSENKTGSF     71 - 140
LIRESESQKGEFSLSVLDGAVVKHYRIKRLDEGGFFLTRRRIFSTLNEFVSHYTKTSDGLCVKLGKPCLK    141 - 210
IQVPAPFDLSYKTVDQWEIDRNSIQLLKRLGSGQFGEVWEGLWNNTTPVAVKTLKPGSMDPNDFLREAQI    211 - 280
MKNLRHPKLIQLYAVCTLEDPIYIITELMRHGSLQEYLQNDTGSKIHLTQQVDMAAQVASGMAYLESRNY    281 - 350
IHRDLAARNVLVGEHNIYKVADFGLARVFKVDNEDIYESRHEIKLPVKWTAPEAIRSNKFSIKSDVWSFG    351 - 420
ILLYEIITYGKMPYSGMTGAQVIQMLAQNYRLPQPSNCPQQFYNIMLECWNAEPKERPTFETLRWKLEDY    421 - 490
FETDSSYSDANNFIR                                                           491 - 505
//

Text Mined References (37)

PMID Year Title
25783528 2015 Antagomir-1290 suppresses CD133? cells in non-small cell lung cancer by targeting fyn-related Src family tyrosine kinase.
25416956 2014 A proteome-scale map of the human interactome network.
24969324 2015 FRK inhibits migration and invasion of human glioma cells by promoting N-cadherin/?-catenin complex formation.
24792491 2014 FRK suppresses the proliferation of human glioma cells by inhibiting cyclin D1 nuclear accumulation.
24735922 2014 Genomic profiling of hepatocellular adenomas reveals recurrent FRK-activating mutations and the mechanisms of malignant transformation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24097068 2013 Discovery and refinement of loci associated with lipid levels.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23318459 2014 The Rak/Frk tyrosine kinase associates with and internalizes the epidermal growth factor receptor.
More...