Property Summary

NCBI Gene PubMed Count 69
Grant Count 25
R01 Count 10
Funding $5,746,573.81
PubMed Score 62.25
PubTator Score 44.93

Knowledge Summary

Patent (8,984,519)

Expression

  Differential Expression (4)

Disease log2 FC p
tuberculosis -1.200 0.000
intraductal papillary-mucinous neoplasm ... -1.100 0.012
group 3 medulloblastoma 1.200 0.001
ovarian cancer 1.300 0.000

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (26)

PMID Text
25694433 Two distinct interfaces mediate direct binding of integrin beta1 with Arg in vitro and in cells and promote Arg kinase activation.
25373509 the ETV6/ARG oncoprotein contributes to autonomous cell growth by compensating for the requirement of growth factor through activating STAT5 signaling, which leads to the up-regulation of c-Myc.
24464651 Knockdown of ABL2 promoted cell invasion and migration and we identified miR-20a-induced cell invasion and migration can be rescued by ABL2.
24096484 Data shows that c-Abl and Arg induce NM23-H1 degradation by increasing expression and activation of cathepsin L and B, which directly cleave NM23-H1 in the lysosome.
23707396 ARG isoforms's cellular location modulate cell morphology, motility, the cytoskeleton, and focal adhesions.
23648710 data provide evidence that Aurora A, AMPK, ABL and CDKs are functionally integrated into human cytomegalovirus (HCMV) replication; inhibition of AMPK and ABL kinases exerted a negative effect, inhibition of Aurora A kinase a slightly positive effect on HCMV replication
23552693 Beta1 integrin regulates Arg to promote invadopodial maturation and matrix degradation.
22777352 Arg acts as a switch in metastatic cancer cells that governs the decision to 'grow or go' (divide or invade).
21892207 c-Abl and Arg not only promote in vitro processes important for melanoma progression, but also promote metastasis in vivo
21543883 Knockout mutation of p27-p55 operon in Mycobacterium bovis severely decreased the virulence of the bacteria when assessed in a progressive model of pulmonary tuberculosis in Balb/c mice.
More...

AA Sequence

MGQQVGRVGEAPGLQQPQPRGIRGSSAARPSGRRRDPAGRTTETGFNIFTQHDHFASCVEDGFEGDKTGG      1 - 70
SSPEALHRPYGCDVEPQALNEAIRWSSKENLLGATESDPNLFVALYDFVASGDNTLSITKGEKLRVLGYN     71 - 140
QNGEWSEVRSKNGQGWVPSNYITPVNSLEKHSWYHGPVSRSAAEYLLSSLINGSFLVRESESSPGQLSIS    141 - 210
LRYEGRVYHYRINTTADGKVYVTAESRFSTLAELVHHHSTVADGLVTTLHYPAPKCNKPTVYGVSPIHDK    211 - 280
WEMERTDITMKHKLGGGQYGEVYVGVWKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGV    281 - 350
CTLEPPFYIVTEYMPYGNLLDYLRECNREEVTAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGEN    351 - 420
HVVKVADFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNTFSIKSDVWAFGVLLWEIATYGMSPYPGID    421 - 490
LSQVYDLLEKGYRMEQPEGCPPKVYELMRACWKWSPADRPSFAETHQAFETMFHDSSISEEVAEELGRAA    491 - 560
SSSSVVPYLPRLPILPSKTRTLKKQVENKENIEGAQDATENSASSLAPGFIRGAQASSGSPALPRKQRDK    561 - 630
SPSSLLEDAKETCFTRDRKGGFFSSFMKKRNAPTPPKRSSSFREMENQPHKKYELTGNFSSVASLQHADG    631 - 700
FSFTPAQQEANLVPPKCYGGSFAQRNLCNDDGGGGGGSGTAGGGWSGITGFFTPRLIKKTLGLRAGKPTA    701 - 770
SDDTSKPFPRSNSTSSMSSGLPEQDRMAMTLPRNCQRSKLQLERTVSTSSQPEENVDRANDMLPKKSEES    771 - 840
AAPSRERPKAKLLPRGATALPLRTPSGDLAITEKDPPGVGVAGVAAAPKGKEKNGGARLGMAGVPEDGEQ    841 - 910
PGWPSPAKAAPVLPTTHNHKVPVLISPTLKHTPADVQLIGTDSQGNKFKLLSEHQVTSSGDKDRPRRVKP    911 - 980
KCAPPPPPVMRLLQHPSICSDPTEEPTALTAGQSTSETQEGGKKAALGAVPISGKAGRPVMPPPQVPLPT    981 - 1050
SSISPAKMANGTAGTKVALRKTKQAAEKISADKISKEALLECADLLSSALTEPVPNSQLVDTGHQLLDYC   1051 - 1120
SGYVDCIPQTRNKFAFREAVSKLELSLQELQVSSAAAGVPGTNPVLNNLLSCVQEISDVVQR           1121 - 1182
//

Text Mined References (91)

PMID Year Title
26420826 2015 Mammalian splicing factor SF1 interacts with SURP domains of U2 snRNP-associated proteins.
25694433 2015 Direct interactions with the integrin ?1 cytoplasmic tail activate the Abl2/Arg kinase.
25373509 2015 ETV6/ARG oncoprotein confers autonomous cell growth by enhancing c-Myc expression via signal transducer and activator of transcription 5 activation in the acute promyelocytic leukemia cell line HT93A.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
24728074 2014 Enhanced prediction of Src homology 2 (SH2) domain binding potentials using a fluorescence polarization-derived c-Met, c-Kit, ErbB, and androgen receptor interactome.
24658140 2014 The mammalian-membrane two-hybrid assay (MaMTH) for probing membrane-protein interactions in human cells.
24464651 2014 miR-20a promotes prostate cancer invasion and migration through targeting ABL2.
24367707 2013 Abl family kinases regulate endothelial barrier function in vitro and in mice.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24096484 2014 c-Abl and Arg induce cathepsin-mediated lysosomal degradation of the NM23-H1 metastasis suppressor in invasive cancer.
More...