Property Summary

NCBI Gene PubMed Count 25
PubMed Score 168.17
PubTator Score 294.26

Knowledge Summary

Patent (50,553)


  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma -1.900 0.000
osteosarcoma -1.760 0.002
Common variable immunodeficiency -1.421 0.021
lung carcinoma -1.500 0.000


Accession P42681 Q14220
Symbols RLK





  Ortholog (10)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (8)

25593320 These data indicate that PRN694 is a highly selective and potent covalent inhibitor of ITK and RLK, and its extended target residence time enables durable attenuation of effector cells in vitro and in vivo.
20800603 Observational study of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
18941202 Itk and Txk exert their effects on T helper (Th) cell differentiation and function at the level of expression; transgenic Txk is not a specific regulator of Th1 responses.
16809408 Th1 cells expressing Txk and Th1-associated cytokines may play a critical role in the development of skin and intestinal lesions in patients with Behcet's disease.
11859127 fuctions as a Th1 cell-specific transcription factor and regulates IFN-gamma gene transcription

AA Sequence

APMSIYEVMYSCWHEKPEGRPTFAELLRAVTEIAETW                                     491 - 527

Text Mined References (28)

PMID Year Title
25593320 2015 Targeting interleukin-2-inducible T-cell kinase (ITK) and resting lymphocyte kinase (RLK) using a novel covalent inhibitor PRN694.
24728074 2014 Enhanced prediction of Src homology 2 (SH2) domain binding potentials using a fluorescence polarization-derived c-Met, c-Kit, ErbB, and androgen receptor interactome.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19290923 2009 Tec kinases regulate T-lymphocyte development and function: new insights into the roles of Itk and Rlk/Txk.
18941202 2008 Selective expression rather than specific function of Txk and Itk regulate Th1 and Th2 responses.
17344846 2007 Patterns of somatic mutation in human cancer genomes.