Property Summary

NCBI Gene PubMed Count 55
Grant Count 172
R01 Count 113
Funding $19,064,443.03
PubMed Score 9.12
PubTator Score 60.84

Knowledge Summary

Patent (122,028)

Expression

  Differential Expression (1)

Disease log2 FC p
lung carcinoma -1.200 0.000

Synonym

Accession P42680 B7ZKZ6 Q3MIS5
Symbols PSCTK4

Gene

TEC

PDB

2LUL  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

 GWAS Trait (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (19)

PMID Text
24722985 These results provide the first evidence that Nef interacts with cytoplasmic tyrosine kinases of the Tec family and suggest that Nef provides a mechanistic link between HIV-1 and Itk signaling in the viral life cycle.
24722985 A cell-based bimolecular fluorescence complementation assay demonstrates that HIV-1 Nef interacts with the Tec family members Bmx, Btk, and Itk but not Tec or Txk. Mutation A96I in the Tec SH3 domain dramatically enhances interaction with Nef
23260110 A cell-based bimolecular fluorescence complementation assay demonstrates that HIV-1 Nef interacts with the Tec family members Bmx, Btk, and Itk but not Tec or Txk. Mutation A96I in the Tec SH3 domain dramatically enhances interaction with Nef
22581839 results suggest that the oncogenic effect of the t(3;9) translocation may be due to the TFG-TEC chimeric protein and that fusion of the TFG (NTD) to the TEC protein produces a gain-of-function chimeric product
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20230531 Tec kinase has a crucial role in regulating FGF2 secretion under various physiological conditions
19913121 Observational study of gene-disease association. (HuGE Navigator)
19883687 inhibits CD25 expression in human T-lymphocytes
19393603 LPS-induced actin polymerization as well as MCP-1, tumor necrosis factor-alpha, interleukin-6, and interleukin-1beta expression are dependent on Tec kinase activity.
More...

AA Sequence

MNFNTILEEILIKRSQQKKKTSPLNYKERLFVLTKSMLTYYEGRAEKKYRKGFIDVSKIKCVEIVKNDDG      1 - 70
VIPCQNKYPFQVVHDANTLYIFAPSPQSRDLWVKKLKEEIKNNNNIMIKYHPKFWTDGSYQCCRQTEKLA     71 - 140
PGCEKYNLFESSIRKALPPAPETKKRRPPPPIPLEEEDNSEEIVVAMYDFQAAEGHDLRLERGQEYLILE    141 - 210
KNDVHWWRARDKYGNEGYIPSNYVTGKKSNNLDQYEWYCRNMNRSKAEQLLRSEDKEGGFMVRDSSQPGL    211 - 280
YTVSLYTKFGGEGSSGFRHYHIKETTTSPKKYYLAEKHAFGSIPEIIEYHKHNAAGLVTRLRYPVSVKGK    281 - 350
NAPTTAGFSYEKWEINPSELTFMRELGSGLFGVVRLGKWRAQYKVAIKAIREGAMCEEDFIEEAKVMMKL    351 - 420
THPKLVQLYGVCTQQKPIYIVTEFMERGCLLNFLRQRQGHFSRDVLLSMCQDVCEGMEYLERNSFIHRDL    421 - 490
AARNCLVSEAGVVKVSDFGMARYVLDDQYTSSSGAKFPVKWCPPEVFNYSRFSSKSDVWSFGVLMWEVFT    491 - 560
EGRMPFEKYTNYEVVTMVTRGHRLYQPKLASNYVYEVMLRCWQEKPEGRPSFEDLLRTIDELVECEETFG    561 - 630
R//

Text Mined References (60)

PMID Year Title
24728074 2014 Enhanced prediction of Src homology 2 (SH2) domain binding potentials using a fluorescence polarization-derived c-Met, c-Kit, ErbB, and androgen receptor interactome.
24722985 2014 The accessory factor Nef links HIV-1 to Tec/Btk kinases in an Src homology 3 domain-dependent manner.
24390342 2014 Genetics of rheumatoid arthritis contributes to biology and drug discovery.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
22581839 2012 The TFG-TEC fusion gene created by the t(3;9) translocation in human extraskeletal myxoid chondrosarcomas encodes a more potent transcriptional activator than TEC.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20230531 2010 Tec-kinase-mediated phosphorylation of fibroblast growth factor 2 is essential for unconventional secretion.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19883687 2010 Tec protein tyrosine kinase inhibits CD25 expression in human T-lymphocyte.
More...