Property Summary

NCBI Gene PubMed Count 43
Grant Count 22
R01 Count 8
Funding $1,885,630.15
PubMed Score 745.73
PubTator Score 576.60

Knowledge Summary

Patent (43,586)

Expression

  Differential Expression (8)

Disease log2 FC p
ependymoma -1.400 0.000
glioblastoma -2.500 0.000
medulloblastoma -2.000 0.000
astrocytoma -1.200 0.007
atypical teratoid / rhabdoid tumor -2.200 0.000
primitive neuroectodermal tumor -2.000 0.000
adult high grade glioma -2.400 0.000
pilocytic astrocytoma -2.000 0.000

Gene RIF (13)

PMID Text
21799000 After IGF-I stimulation, CTK is recruited to IGF-IR and its recruitment facilitates CTK's subsequent association with phospho-SHPS-1.
18292939 CHK is capable of inhibiting the CXCL12-CXCR4 pathway in neuroblastoma.
17934522 These results reveal a potentially important role for CHK in Src activation and tumorigenicity in colon cancer cells.
17492661 Progesterone increases MATK in mast cells and reducs cell proliferation.
16707123 Findings indicate that the importance of the N-terminal domain to Chk-induced tyrosine phosphorylation in the nucleus, and implicate that nuclear tyrosine-phosphorylated proteins may contribute to inhibition of cell proliferation.
16574955 Matk/CHK is not functionally redundant with Csk, and this tyrosine kinase plays an important role as a regulator of immunologic responses
16168623 This study describes for the first time the Src-independent actions of CHK and provides novel insights into CHK function in neural cells.
15890649 striking functional differences between the Csk and Chk SH2 domains and revealed functional similarities between the Chk and Src SH2 domains
15748901 Nuclear multi-lobulation in late S phase, which is dependent on polymerization and depolymerization of microtubules, may be involved in nuclear Chk-induced inhibition of proliferation.
15329911 Loss of CHK expression is associated with human brain tumors
More...

AA Sequence

MAGRGSLVSWRAFHGCDSAEELPRVSPRFLRAWHPPPVSARMPTRRWAPGTQCITKCEHTRPKPGELAFR      1 - 70
KGDVVTILEACENKSWYRVKHHTSGQEGLLAAGALREREALSADPKLSLMPWFHGKISGQEAVQQLQPPE     71 - 140
DGLFLVRESARHPGDYVLCVSFGRDVIHYRVLHRDGHLTIDEAVFFCNLMDMVEHYSKDKGAICTKLVRP    141 - 210
KRKHGTKSAEEELARAGWLLNLQHLTLGAQIGEGEFGAVLQGEYLGQKVAVKNIKCDVTAQAFLDETAVM    211 - 280
TKMQHENLVRLLGVILHQGLYIVMEHVSKGNLVNFLRTRGRALVNTAQLLQFSLHVAEGMEYLESKKLVH    281 - 350
RDLAARNILVSEDLVAKVSDFGLAKAERKGLDSSRLPVKWTAPEALKHGKFTSKSDVWSFGVLLWEVFSY    351 - 420
GRAPYPKMSLKEVSEAVEKGYRMEPPEGCPGPVHVLMSSCWEAEPARRPPFRKLAEKLARELRSAGAPAS    421 - 490
VSGQDADGSTSPRSQEP                                                         491 - 507
//

Text Mined References (52)

PMID Year Title
24947832 2014 Differential protein-protein interactions of LRRK1 and LRRK2 indicate roles in distinct cellular signaling pathways.
24728074 2014 Enhanced prediction of Src homology 2 (SH2) domain binding potentials using a fluorescence polarization-derived c-Met, c-Kit, ErbB, and androgen receptor interactome.
24510904 2014 Unbiased screen for interactors of leucine-rich repeat kinase 2 supports a common pathway for sporadic and familial Parkinson disease.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22939624 2012 Quantitative analysis of HSP90-client interactions reveals principles of substrate recognition.
21799000 2011 IGF-I stimulates cooperative interaction between the IGF-I receptor and CSK homologous kinase that regulates SHPS-1 phosphorylation in vascular smooth muscle cells.
21697133 2011 Full-length transcriptome analysis of human retina-derived cell lines ARPE-19 and Y79 using the vector-capping method.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
More...