Property Summary

NCBI Gene PubMed Count 43
PubMed Score 792.26
PubTator Score 576.60

Knowledge Summary

Patent (43,586)

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma -2.400 1.7e-05
astrocytoma -1.200 7.3e-03
Astrocytoma, Pilocytic -1.900 3.3e-06
atypical teratoid / rhabdoid tumor -2.200 9.3e-10
ependymoma -1.400 5.4e-06
glioblastoma -1.700 1.7e-06
group 4 medulloblastoma -1.900 2.7e-04
primitive neuroectodermal tumor -2.000 2.2e-04

Gene RIF (13)

AA Sequence

MAGRGSLVSWRAFHGCDSAEELPRVSPRFLRAWHPPPVSARMPTRRWAPGTQCITKCEHTRPKPGELAFR      1 - 70
KGDVVTILEACENKSWYRVKHHTSGQEGLLAAGALREREALSADPKLSLMPWFHGKISGQEAVQQLQPPE     71 - 140
DGLFLVRESARHPGDYVLCVSFGRDVIHYRVLHRDGHLTIDEAVFFCNLMDMVEHYSKDKGAICTKLVRP    141 - 210
KRKHGTKSAEEELARAGWLLNLQHLTLGAQIGEGEFGAVLQGEYLGQKVAVKNIKCDVTAQAFLDETAVM    211 - 280
TKMQHENLVRLLGVILHQGLYIVMEHVSKGNLVNFLRTRGRALVNTAQLLQFSLHVAEGMEYLESKKLVH    281 - 350
RDLAARNILVSEDLVAKVSDFGLAKAERKGLDSSRLPVKWTAPEALKHGKFTSKSDVWSFGVLLWEVFSY    351 - 420
GRAPYPKMSLKEVSEAVEKGYRMEPPEGCPGPVHVLMSSCWEAEPARRPPFRKLAEKLARELRSAGAPAS    421 - 490
VSGQDADGSTSPRSQEP                                                         491 - 507
//

Text Mined References (52)

PMID Year Title