Property Summary

NCBI Gene PubMed Count 27
PubMed Score 30.24
PubTator Score 34.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (2)

Expression

Synonym

Accession P42677 Q5T4L6
Symbols S27
MPS1
MPS-1

Gene

PDB

4UG0   4V6X   5AJ0   5A2Q   5FLX  

Gene RIF (9)

PMID Text
25424902 Loss of function mutations in RPL27 and RPS27 lead to Diamond-Blackfan anaemia.
24913145 We identified frequent recurrent (i.e. hotspot) mutation in the 5' untranslated region of RPS27 in ~10% of melanoma samples
22798506 The data on genome context analysis indicates that the presence of MPS-1 in the blood is an indicator of oncogenesis
21796632 a novel pathway, the MPS-1/NF-kappaB/Gadd45beta signal pathway, played an important role in MPS-1 knockdown-induced apoptosis of gastric cancer cells.
21518817 This work is consistent with a critical role of RPMPS-1/S27 in the life cycle of various viruses and shows that disruption of viral ZFPs is potentially important to control and prevent deathly viral diseases
21170087 study reveals a multilevel interplay between RPS27L/S27 and p53-MDM2 axis, with RPS27L functioning as a p53 target, a MDM2 substrate and a p53 regulator
19642098 When MPS-1 is overexpressed, it has an extraribosomal function as a strong inhibitor of HNSCC tumor cell growth, which may be exerted by reduced paxillin gene expression.
19460752 Knockdown of ribosomal protein S27 (RPS27) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
16914586 MPS-1 was overexpressed in 86% of the gastric cancer tissues and all gastric cancer cells. MPS-1 expression was significantly increased and corresponded with the tumor-node-metastasis clinical stage, and was significantly higher in the late stage.

AA Sequence

MPLAKDLLHPSPEEEKRKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGK      1 - 70
ARLTEGCSFRRKQH                                                             71 - 84
//

Text Mined References (35)

PMID Year Title
25424902 2015 Loss of function mutations in RPL27 and RPS27 identified by whole-exome sequencing in Diamond-Blackfan anaemia.
24913145 2014 A highly recurrent RPS27 5'UTR mutation in melanoma.
24725412 2014 Ribosomal protein s15 phosphorylation mediates LRRK2 neurodegeneration in Parkinson's disease.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22798506 Increased serum level of RPMPS-1/S27 protein in patients with various types of cancer is useful for the early detection, prevention and therapy.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21796632 2012 Knockdown of metallopanstimulin-1 inhibits NF-?B signaling at different levels: the role of apoptosis induction of gastric cancer cells.
More...