Property Summary

Ligand Count 5
NCBI Gene PubMed Count 40
PubMed Score 31.89
PubTator Score 34.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
DIAMOND-BLACKFAN ANEMIA 17 1 0.0 0.0
Disease Target Count Z-score Confidence
Diamond-Blackfan anemia 31 3.28 1.6
Disease Target Count Z-score Confidence
Irregular astigmatism 12 3.665 1.8

Expression

Gene RIF (12)

AA Sequence

MPLAKDLLHPSPEEEKRKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGK      1 - 70
ARLTEGCSFRRKQH                                                             71 - 84
//

Text Mined References (49)

PMID Year Title