Property Summary

NCBI Gene PubMed Count 51
PubMed Score 107.96
PubTator Score 77.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (7)

Disease Target Count P-value
Breast cancer 3099 1.2007039984999E-25
lung carcinoma 2844 1.49205754250375E-17
ovarian cancer 8492 2.34362628921159E-10
posterior fossa group A ependymoma 1511 4.3214447452515E-9
osteosarcoma 7933 1.81808388177806E-7
medulloblastoma, large-cell 6234 9.60675494962304E-6
sonic hedgehog group medulloblastoma 1482 1.9921615951998E-4
colon cancer 1475 4.14509925262577E-4
atypical teratoid / rhabdoid tumor 4369 7.22984131400853E-4
cutaneous lupus erythematosus 1056 0.00110105652065835
primitive neuroectodermal tumor 3031 0.00235899526853849
Pick disease 1893 0.00884093135497753
aldosterone-producing adenoma 664 0.00939683268429327
pituitary cancer 1972 0.0146846418679604
pediatric high grade glioma 2712 0.0170053651744621
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0237867205616396
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0268553953141308
subependymal giant cell astrocytoma 2287 0.0314717993049997
glioblastoma 5572 0.038118602665468
Disease Target Count Z-score Confidence
Intellectual disability 573 0.0 4.0
Neurodegenerative disease 383 0.0 4.0
Disease Target Count Z-score Confidence
Encephalitis 54 3.491 1.7
Stiff-Person syndrome 11 3.057 1.5

Expression

Synonym

Accession P42658
Symbols VF2
DPL1
DPPX
MRD33

Gene

PDB

1XFD  

  Ortholog (10)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Opossum OMA Inparanoid
Platypus OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
S.cerevisiae OMA Inparanoid

Gene RIF (37)

PMID Text
25190807 the cysteine-rich domain of DPP6 plays an important role in protein folding of DPP6 that is required for transport of DPP6/Kv4.2 complexes out of the ER
25129042 This first familial case provides evidence for association between DPP6 haploinsufficiency and Gilles de la Tourette syndrome.
24677629 DPP6 is critical for synaptic integration and excitation.
24225951 WT PrP(C), in a DPP6-dependent manner, modulated Kv4.2 channel properties, causing an increase in peak amplitude
23832105 Two DPP6 de novo deletions and one missense mutation in familial microcephalic patients were identified.
23532596 DPP6-mediated Purkinje fibers early-repolarization syndrome might be a novel molecular paradigm for some forms of idiopathic ventricular fibrillation.
23225603 Antibodies to DPPX are associated with a protracted encephalitis characterized by central nervous system hyperexcitability.
23069673 These results, inflated by the limited sample size determined by the rarity of this condition, suggest a possible role of this gene in the susceptibility to PrMS, at least in Southern Europeans.
22479372 Results showed that DPP6, SPHKAP and ID4 were down regulated in acute myeloid leukemia (AML) patients.
21826085 Findings of this study indicate that an altered response of Kv4/DPP6 to long-term neuroleptic administration is involved in neuroleptic-induced TD.
More...

AA Sequence

MASLYQRFTGKINTSRSFPAPPEASHLLGGQGPEEDGGAGAKPLGPRAQAAAPRERGGGGGGAGGRPRFQ      1 - 70
YQARSDGDEEDELVGSNPPQRNWKGIAIALLVILVICSLIVTSVILLTPAEDNSLSQKKKVTVEDLFSED     71 - 140
FKIHDPEAKWISDTEFIYREQKGTVRLWNVETNTSTVLIEGKKIESLRAIRYEISPDREYALFSYNVEPI    141 - 210
YQHSYTGYYVLSKIPHGDPQSLDPPEVSNAKLQYAGWGPKGQQLIFIFENNIYYCAHVGKQAIRVVSTGK    211 - 280
EGVIYNGLSDWLYEEEILKTHIAHWWSPDGTRLAYAAINDSRVPIMELPTYTGSIYPTVKPYHYPKAGSE    281 - 350
NPSISLHVIGLNGPTHDLEMMPPDDPRMREYYITMVKWATSTKVAVTWLNRAQNVSILTLCDATTGVCTK    351 - 420
KHEDESEAWLHRQNEEPVFSKDGRKFFFIRAIPQGGRGKFYHITVSSSQPNSSNDNIQSITSGDWDVTKI    421 - 490
LAYDEKGNKIYFLSTEDLPRRRQLYSANTVGNFNRQCLSCDLVENCTYFSASFSHSMDFFLLKCEGPGVP    491 - 560
MVTVHNTTDKKKMFDLETNEHVKKAINDRQMPKVEYRDIEIDDYNLPMQILKPATFTDTTHYPLLLVVDG    561 - 630
TPGSQSVAEKFEVSWETVMVSSHGAVVVKCDGRGSGFQGTKLLHEVRRRLGLLEEKDQMEAVRTMLKEQY    631 - 700
IDRTRVAVFGKDYGGYLSTYILPAKGENQGQTFTCGSALSPITDFKLYASAFSERYLGLHGLDNRAYEMT    701 - 770
KVAHRVSALEEQQFLIIHPTADEKIHFQHTAELITQLIRGKANYSLQIYPDESHYFTSSSLKQHLYRSII    771 - 840
NFFVECFRIQDKLLTVTAKEDEEED                                                 841 - 865
//

Text Mined References (54)

PMID Year Title
25190807 2014 DPP6 domains responsible for its localization and function.
25129042 2014 DPP6 gene disruption in a family with Gilles de la Tourette syndrome.
24743840 2014 Genome-wide diet-gene interaction analyses for risk of colorectal cancer.
24677629 2014 A genome-wide association study of clinical symptoms of dissociation in a trauma-exposed sample.
24225951 2013 The prion protein modulates A-type K+ currents mediated by Kv4.2 complexes through dipeptidyl aminopeptidase-like protein 6.
23832105 2013 Loss-of-function variation in the DPP6 gene is associated with autosomal dominant microcephaly and mental retardation.
23593319 2013 A new TASK for Dipeptidyl Peptidase-like Protein 6.
23534349 2013 Generalization of variants identified by genome-wide association studies for electrocardiographic traits in African Americans.
23532596 2013 Unique cardiac Purkinje fiber transient outward current ?-subunit composition: a potential molecular link to idiopathic ventricular fibrillation.
23527680 2013 Genome-wide association study of inattention and hyperactivity-impulsivity measured as quantitative traits.
More...