Property Summary

NCBI Gene PubMed Count 53
PubMed Score 114.78
PubTator Score 77.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Disease Target Count Z-score Confidence
Neurodegenerative disease 414 0.0 4.0
Disease Target Count Z-score Confidence
Encephalitis 64 4.122 2.1
Hyperekplexia 16 3.988 2.0
Choreatic disease 52 3.005 1.5

Expression

  Differential Expression (19)

Disease log2 FC p
adult high grade glioma -1.100 9.1e-04
aldosterone-producing adenoma -1.218 9.4e-03
atypical teratoid / rhabdoid tumor -1.700 2.9e-04
Breast cancer -1.500 1.2e-25
colon cancer -1.500 4.1e-04
cutaneous lupus erythematosus -1.900 1.1e-03
ependymoma -1.700 1.8e-07
glioblastoma -1.200 1.8e-02
group 3 medulloblastoma -1.600 1.0e-06
intraductal papillary-mucinous adenoma (... -1.700 2.4e-02
intraductal papillary-mucinous carcinoma... -1.700 2.7e-02
lung carcinoma 2.700 1.5e-17
medulloblastoma, large-cell -3.000 1.9e-06
osteosarcoma 1.735 1.8e-07
ovarian cancer -3.200 2.3e-10
Pick disease -1.500 8.8e-03
pituitary cancer -1.700 1.4e-02
primitive neuroectodermal tumor -1.900 3.1e-03
subependymal giant cell astrocytoma -2.162 2.9e-02

 MGI Phenotype (1)

Protein-protein Interaction (8)

Gene RIF (39)

AA Sequence

MASLYQRFTGKINTSRSFPAPPEASHLLGGQGPEEDGGAGAKPLGPRAQAAAPRERGGGGGGAGGRPRFQ      1 - 70
YQARSDGDEEDELVGSNPPQRNWKGIAIALLVILVICSLIVTSVILLTPAEDNSLSQKKKVTVEDLFSED     71 - 140
FKIHDPEAKWISDTEFIYREQKGTVRLWNVETNTSTVLIEGKKIESLRAIRYEISPDREYALFSYNVEPI    141 - 210
YQHSYTGYYVLSKIPHGDPQSLDPPEVSNAKLQYAGWGPKGQQLIFIFENNIYYCAHVGKQAIRVVSTGK    211 - 280
EGVIYNGLSDWLYEEEILKTHIAHWWSPDGTRLAYAAINDSRVPIMELPTYTGSIYPTVKPYHYPKAGSE    281 - 350
NPSISLHVIGLNGPTHDLEMMPPDDPRMREYYITMVKWATSTKVAVTWLNRAQNVSILTLCDATTGVCTK    351 - 420
KHEDESEAWLHRQNEEPVFSKDGRKFFFIRAIPQGGRGKFYHITVSSSQPNSSNDNIQSITSGDWDVTKI    421 - 490
LAYDEKGNKIYFLSTEDLPRRRQLYSANTVGNFNRQCLSCDLVENCTYFSASFSHSMDFFLLKCEGPGVP    491 - 560
MVTVHNTTDKKKMFDLETNEHVKKAINDRQMPKVEYRDIEIDDYNLPMQILKPATFTDTTHYPLLLVVDG    561 - 630
TPGSQSVAEKFEVSWETVMVSSHGAVVVKCDGRGSGFQGTKLLHEVRRRLGLLEEKDQMEAVRTMLKEQY    631 - 700
IDRTRVAVFGKDYGGYLSTYILPAKGENQGQTFTCGSALSPITDFKLYASAFSERYLGLHGLDNRAYEMT    701 - 770
KVAHRVSALEEQQFLIIHPTADEKIHFQHTAELITQLIRGKANYSLQIYPDESHYFTSSSLKQHLYRSII    771 - 840
NFFVECFRIQDKLLTVTAKEDEEED                                                 841 - 865
//

Text Mined References (56)

PMID Year Title