Property Summary

NCBI Gene PubMed Count 51
Grant Count 41
R01 Count 24
Funding $4,799,785.03
PubMed Score 107.96
PubTator Score 77.73

Knowledge Summary

Patent

No data available

Expression

Gene RIF (37)

PMID Text
25190807 the cysteine-rich domain of DPP6 plays an important role in protein folding of DPP6 that is required for transport of DPP6/Kv4.2 complexes out of the ER
25129042 This first familial case provides evidence for association between DPP6 haploinsufficiency and Gilles de la Tourette syndrome.
24677629 DPP6 is critical for synaptic integration and excitation.
24225951 WT PrP(C), in a DPP6-dependent manner, modulated Kv4.2 channel properties, causing an increase in peak amplitude
23832105 Two DPP6 de novo deletions and one missense mutation in familial microcephalic patients were identified.
23532596 DPP6-mediated Purkinje fibers early-repolarization syndrome might be a novel molecular paradigm for some forms of idiopathic ventricular fibrillation.
23225603 Antibodies to DPPX are associated with a protracted encephalitis characterized by central nervous system hyperexcitability.
23069673 These results, inflated by the limited sample size determined by the rarity of this condition, suggest a possible role of this gene in the susceptibility to PrMS, at least in Southern Europeans.
22479372 Results showed that DPP6, SPHKAP and ID4 were down regulated in acute myeloid leukemia (AML) patients.
21826085 Findings of this study indicate that an altered response of Kv4/DPP6 to long-term neuroleptic administration is involved in neuroleptic-induced TD.
More...

AA Sequence

MASLYQRFTGKINTSRSFPAPPEASHLLGGQGPEEDGGAGAKPLGPRAQAAAPRERGGGGGGAGGRPRFQ      1 - 70
YQARSDGDEEDELVGSNPPQRNWKGIAIALLVILVICSLIVTSVILLTPAEDNSLSQKKKVTVEDLFSED     71 - 140
FKIHDPEAKWISDTEFIYREQKGTVRLWNVETNTSTVLIEGKKIESLRAIRYEISPDREYALFSYNVEPI    141 - 210
YQHSYTGYYVLSKIPHGDPQSLDPPEVSNAKLQYAGWGPKGQQLIFIFENNIYYCAHVGKQAIRVVSTGK    211 - 280
EGVIYNGLSDWLYEEEILKTHIAHWWSPDGTRLAYAAINDSRVPIMELPTYTGSIYPTVKPYHYPKAGSE    281 - 350
NPSISLHVIGLNGPTHDLEMMPPDDPRMREYYITMVKWATSTKVAVTWLNRAQNVSILTLCDATTGVCTK    351 - 420
KHEDESEAWLHRQNEEPVFSKDGRKFFFIRAIPQGGRGKFYHITVSSSQPNSSNDNIQSITSGDWDVTKI    421 - 490
LAYDEKGNKIYFLSTEDLPRRRQLYSANTVGNFNRQCLSCDLVENCTYFSASFSHSMDFFLLKCEGPGVP    491 - 560
MVTVHNTTDKKKMFDLETNEHVKKAINDRQMPKVEYRDIEIDDYNLPMQILKPATFTDTTHYPLLLVVDG    561 - 630
TPGSQSVAEKFEVSWETVMVSSHGAVVVKCDGRGSGFQGTKLLHEVRRRLGLLEEKDQMEAVRTMLKEQY    631 - 700
IDRTRVAVFGKDYGGYLSTYILPAKGENQGQTFTCGSALSPITDFKLYASAFSERYLGLHGLDNRAYEMT    701 - 770
KVAHRVSALEEQQFLIIHPTADEKIHFQHTAELITQLIRGKANYSLQIYPDESHYFTSSSLKQHLYRSII    771 - 840
NFFVECFRIQDKLLTVTAKEDEEED                                                 841 - 865
//

Text Mined References (54)

PMID Year Title
25190807 2014 DPP6 domains responsible for its localization and function.
25129042 2014 DPP6 gene disruption in a family with Gilles de la Tourette syndrome.
24743840 2014 Genome-wide diet-gene interaction analyses for risk of colorectal cancer.
24677629 2014 A genome-wide association study of clinical symptoms of dissociation in a trauma-exposed sample.
24225951 2013 The prion protein modulates A-type K+ currents mediated by Kv4.2 complexes through dipeptidyl aminopeptidase-like protein 6.
23832105 2013 Loss-of-function variation in the DPP6 gene is associated with autosomal dominant microcephaly and mental retardation.
23593319 2013 A new TASK for Dipeptidyl Peptidase-like Protein 6.
23534349 2013 Generalization of variants identified by genome-wide association studies for electrocardiographic traits in African Americans.
23532596 2013 Unique cardiac Purkinje fiber transient outward current ?-subunit composition: a potential molecular link to idiopathic ventricular fibrillation.
23527680 2013 Genome-wide association study of inattention and hyperactivity-impulsivity measured as quantitative traits.
More...