Property Summary

NCBI Gene PubMed Count 134
PubMed Score 416.44
PubTator Score 296.88

Knowledge Summary


No data available


  Disease Sources (3)

Disease Target Count P-value
glioblastoma multiforme 347 6.18218283483076E-22
juvenile dermatomyositis 1189 5.52702047671684E-15
oligodendroglioma 2849 4.30523408170943E-13
osteosarcoma 7933 1.09503833786399E-12
adrenocortical carcinoma 1427 1.80058886750929E-7
group 3 medulloblastoma 2254 6.20454253525041E-6
pediatric high grade glioma 2712 2.77971930026343E-5
atypical teratoid/rhabdoid tumor 1095 3.46511001700572E-5
ovarian cancer 8492 6.83588991165188E-5
primitive neuroectodermal tumor 3031 1.02940584466133E-4
lung cancer 4473 1.13645624539391E-4
medulloblastoma, large-cell 6234 0.00107073933354461
primary pancreatic ductal adenocarcinoma 1271 0.0105914321681208
pancreatic cancer 2300 0.0177076475825937
pancreatic carcinoma 567 0.0177076475825939
gastric cancer 436 0.0290441345085507
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0336868050071432
Breast cancer 3099 0.0386664008084156
Disease Target Count Z-score Confidence
Cancer 2346 4.364 2.2



Accession P42575 A8K5F9 D3DXD6 E9PDN0 P42576 Q59F21 Q7KZL6 Q86UJ3 Q9BUP7 Q9BZK9 Q9BZL0 CASP-2
Symbols ICH1



1PYO   2P2C   3R5J   3R6G   3R6L   3R7B   3R7N   3R7S   3RJM  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (92)

26962687 These findings indicate that miR-125a-5p decreases after HOTAIR knockdown to promote cancer cell apoptosis by releasing caspase 2.
25330190 We have also demonstrated that these correlations are tissue specific being reduced (CASP9 and CASP10) or different (CASP2) in the liver
25301067 these studies elucidate a Caspase-2-p53 signaling network that impacts lung tumorigenesis and chemotherapy response in vivo.
25151963 the initiator caspase-2 is required for robust death of ovarian cancer cells induced by FASN inhibitors
25114039 Authors have demonstrated in vitro and in vivo that loss of function of caspase-2 allows to escape oncogenic stress induced senescence.
25010987 HuR sensitizes adenocarcinoma cells to the intrinsic apoptotic pathway by upregulating the translation of caspase-2.
24727569 axon regeneration promoted by suppression of CASP2 and CASP6 is CNTF-dependent and mediated through the JAK/STAT signalling pathway
24321384 Our results reveal a novel mechanism of caspase-2 pre-mRNA splicing.
24292555 Data strongly argue against a critical role for caspase-2 in ER-stress-induced apoptosis.
23568547 MiR-708 may act as an oncogene and induce the carcinogenicity of bladder cancer by down-regulating Caspase-2 level.

AA Sequence

APGTEFHRCKEMSEYCSTLCRHLYLFPGHPPT                                          421 - 452

Text Mined References (139)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26962687 2016 MiR-125a-5p decreases after long non-coding RNA HOTAIR knockdown to promote cancer cell apoptosis by releasing caspase 2.
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25416956 2014 A proteome-scale map of the human interactome network.
25330190 2014 Transcriptomic analysis unveils correlations between regulative apoptotic caspases and genes of cholesterol homeostasis in human brain.
25301067 2015 Caspase-2 impacts lung tumorigenesis and chemotherapy response in vivo.
25151963 2015 Fatty acid synthase inhibition engages a novel caspase-2 regulatory mechanism to induce ovarian cancer cell death.
25114039 2014 Caspase-2 regulates oncogene-induced senescence.
25010987 2014 Attenuation of the ELAV1-like protein HuR sensitizes adenocarcinoma cells to the intrinsic apoptotic pathway by increasing the translation of caspase-2L.
24727569 2014 Combined suppression of CASP2 and CASP6 protects retinal ganglion cells from apoptosis and promotes axon regeneration through CNTF-mediated JAK/STAT signalling.