Property Summary

Ligand Count 26
NCBI Gene PubMed Count 145
PubMed Score 431.81
PubTator Score 296.88

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adrenocortical carcinoma 1.245 1.8e-07
adult high grade glioma 1.200 2.9e-03
atypical teratoid/rhabdoid tumor 1.100 3.5e-05
Breast cancer 2.100 4.9e-02
gastric cancer 1.500 2.9e-02
glioblastoma 1.400 3.6e-05
group 3 medulloblastoma 2.200 2.1e-05
intraductal papillary-mucinous carcinoma... 1.100 3.4e-02
juvenile dermatomyositis 1.218 5.5e-15
lung cancer 1.300 2.0e-02
medulloblastoma, large-cell 1.100 2.6e-05
oligodendroglioma 1.100 4.3e-13
osteosarcoma 2.011 1.4e-05
ovarian cancer 1.500 6.8e-05
pancreatic cancer 1.700 1.8e-02
pancreatic carcinoma 1.700 1.8e-02
primary pancreatic ductal adenocarcinoma 1.093 1.1e-02
primitive neuroectodermal tumor 1.200 1.1e-02

Gene RIF (101)

AA Sequence

MAAPSAGSWSTFQHKELMAADRGRRILGVCGMHPHHQETLKKNRVVLAKQLLLSELLEHLLEKDIITLEM      1 - 70
RELIQAKVGSFSQNVELLNLLPKRGPQAFDAFCEALRETKQGHLEDMLLTTLSGLQHVLPPLSCDYDLSL     71 - 140
PFPVCESCPLYKKLRLSTDTVEHSLDNKDGPVCLQVKPCTPEFYQTHFQLAYRLQSRPRGLALVLSNVHF    141 - 210
TGEKELEFRSGGDVDHSTLVTLFKLLGYDVHVLCDQTAQEMQEKLQNFAQLPAHRVTDSCIVALLSHGVE    211 - 280
GAIYGVDGKLLQLQEVFQLFDNANCPSLQNKPKMFFIQACRGDETDRGVDQQDGKNHAGSPGCEESDAGK    281 - 350
EKLPKMRLPTRSDMICGYACLKGTAAMRNTKRGSWYIEALAQVFSERACDMHVADMLVKVNALIKDREGY    351 - 420
APGTEFHRCKEMSEYCSTLCRHLYLFPGHPPT                                          421 - 452
//

Text Mined References (150)

PMID Year Title