Property Summary

NCBI Gene PubMed Count 881
PubMed Score 16628.38
PubTator Score 9598.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
ovarian cancer 8492 2.66068357787497E-6
glioblastoma 5572 2.7012845851918E-4
invasive ductal carcinoma 2950 6.73564070966359E-4
lung cancer 4473 0.00419804426712485
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00570814579071241
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0084089373133094
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0130408329450549

Expression

See source...

Synonym

Accession P42574 A8K5M2 D3DP53 Q96AN1 Q96KP2 CASP-3
Symbols CPP32
SCA-1
CPP32B

Gene

PDB

1CP3   1GFW   1I3O   1NME   1NMQ   1NMS   1PAU   1QX3   1RE1   1RHJ   1RHK   1RHM   1RHQ   1RHR   1RHU   2C1E   2C2K   2C2M   2C2O   2CDR   2CJX   2CJY   2CNK   2CNL   2CNN   2CNO   2DKO   2H5I   2H5J   2H65   2J30   2J31   2J32   2J33   2XYG   2XYH   2XYP   2XZD   2XZT   2Y0B   3DEH   3DEI   3DEJ   3DEK   3EDQ   3GJQ   3GJR   3GJS   3GJT   3H0E   3ITN   3KJF   3PCX   3PD0   3PD1   4DCJ   4DCO   4DCP   4EHA   4EHD   4EHF   4EHH   4EHK   4EHL   4EHN   4JJE   4JQY   4JQZ   4JR0   4PRY   4PS0   4QTX   4QTY   4QU0   4QU5   4QU8   4QU9   4QUA   4QUB   4QUD   4QUE   4QUG   4QUH   4QUI   4QUJ   4QUL   5IC4  

  Ortholog (10)

MLP Assay (26)

AID Type Active / Inconclusive / Inactive Description
463141 screening 350 / 0 / 325786 Absorbance-based primary biochemical high throughput screening assay to identify activators of procaspase-3
463197 summary 0 / 0 / 0 Summary of the probe development efforts to identify activators of procaspase-3
488856 screening 48 / 0 / 1382 Single concentration confirmation of UBC13 Polyubiquitin Inhibitors using a Caspase-3 counter screen
488901 confirmatory 668 / 0 / 36 Dose Response confirmation of inhibitors of Sentrin-specific proteases (SENPs) using a Caspase-3 Selectivity assay
488918 screening 3691 / 0 / 2505 Single concentration confirmation of inhibitors of Sentrin-specific proteases (SENPs) using a Caspase-3 Selectivity assay
488954 screening 18 / 0 / 192 Absorbance-based confirmation biochemical high throughput confirmation assay for activators of procaspase-3
489014 confirmatory 7 / 0 / 18 Absorbance-based biochemical high throughput dose response assay for activators of procaspase-3
493114 screening 5 / 0 / 283 Counterscreen assay for dual activators of procaspase-3 and procaspase-7: Absorbance-based biochemical assay for activators of procaspase-3
504328 confirmatory 0 / 0 / 17 Dose response counterscreen for dual activators of procaspase-3 and procaspase-7: Absorbance-based biochemical high throughput screening assay to identify activators of procaspase-3
504488 confirmatory 117 / 0 / 150 SAR Analysis of small molecule inhibitors of Sentrin-specific proteases (SENPs) using a Caspase-3 Selectivity assay
More...

Gene RIF (744)

PMID Text
26978233 Expression of Caspase 3, including that of survivin, was significantly more frequently detected in the patients who had received combined cytotoxic and anti-VEGF therapy as compared to both those treated with only cytotoxic agents and the control group
26921582 Caspase-3 mainly degraded LMP1 proteins in HeLa cells, leading to decreased NF-kappaB and STAT3 activation. Caspase-3 cleaved the consensus DNTD sequences in the CTAR3 region of LMP1.
26823716 Expression of livin, survivin and caspase-3 are closely related to the occurrence and development of prostatic cancer.
26782454 These results suggest that CASP3 gene polymorphisms may be associated with susceptibility to periodontal disease in the Korean population
26762417 ilvestrol induced caspase-3 activation and apoptotic cell death in a time- and dose-dependent manner
26687534 These findings demonstrated that p21 plays a critical role in furazolidone-induced apoptosis in HepG2 cells by influencing the caspase-3 activation and ROS generation.
26595239 Suggest 2'5'-oligoadenylate synthetase 2 mediates T-cell receptor CD3-zeta chain down-regulation via caspase-3 activation in oral cancer.
26573276 The casp3 cleaved product of Beclin1 promotes apoptosis induced by S1 in SKOV3 cells.
26563540 Excessive TLR9 signaling contributed to maternal-fetal tolerance disruption via an effect on Treg cell survival by activation of Caspase 8/3
26545730 caspase-3 serum levels and mortality are associated in patients with severe traumatic brain injury
More...

AA Sequence

MENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVD      1 - 70
AANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKIT     71 - 140
NFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETDSGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSK    141 - 210
DGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH       211 - 277
//

Text Mined References (889)

PMID Year Title
26978233 [Impact of preoperative drug therapy on the expression of apoptosis markers in colorectal liver metastases].
26921582 2016 Caspase-dependent cleavage regulates protein levels of Epstein-Barr virus-derived latent membrane protein 1.
26823716 2015 Expression of livin, survivin and caspase-3 in prostatic cancer and their clinical significance.
26782454 2015 Assessment of CASP gene polymorphisms in periodontal disease.
26762417 2016 Silvestrol induces early autophagy and apoptosis in human melanoma cells.
26687534 2016 P21(Waf1/Cip1) plays a critical role in furazolidone-induced apoptosis in HepG2 cells through influencing the caspase-3 activation and ROS generation.
26595239 2016 Extracellular 2'5'-oligoadenylate synthetase 2 mediates T-cell receptor CD3-? chain down-regulation via caspase-3 activation in oral cancer.
26573276 2016 Caspase-mediated cleavage of Beclin1 inhibits autophagy and promotes apoptosis induced by S1 in human ovarian cancer SKOV3 cells.
26563540 2015 Excessive TLR9 signaling contributes to the pathogenesis of spontaneous abortion through impairment of Treg cell survival by activation of Caspase 8/3.
26545730 2015 Serum caspase-3 levels and mortality are associated in patients with severe traumatic brain injury.
More...