Property Summary

Ligand Count 726
NCBI Gene PubMed Count 934
PubMed Score 18132.35
PubTator Score 9598.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (7)

See source...

Protein-protein Interaction (2)

PDB (100)

Gene RIF (796)

AA Sequence

MENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVD      1 - 70
AANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKIT     71 - 140
NFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETDSGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSK    141 - 210
DGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH       211 - 277
//

Text Mined References (942)

PMID Year Title