Property Summary

Ligand Count 722
NCBI Gene PubMed Count 934
PubMed Score 18132.35
PubTator Score 9598.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (7)

See source...

Synonym

Accession P42574 A8K5M2 D3DP53 Q96AN1 Q96KP2 CASP-3
Symbols CPP32
SCA-1
CPP32B

Gene

PDB

1CP3   1GFW   1I3O   1NME   1NMQ   1NMS   1PAU   1QX3   1RE1   1RHJ   1RHK   1RHM   1RHQ   1RHR   1RHU   2C1E   2C2K   2C2M   2C2O   2CDR   2CJX   2CJY   2CNK   2CNL   2CNN   2CNO   2DKO   2H5I   2H5J   2H65   2J30   2J31   2J32   2J33   2XYG   2XYH   2XYP   2XZD   2XZT   2Y0B   3DEH   3DEI   3DEJ   3DEK   3EDQ   3GJQ   3GJR   3GJS   3GJT   3H0E   3ITN   3KJF   3PCX   3PD0   3PD1   4DCJ   4DCO   4DCP   4EHA   4EHD   4EHF   4EHH   4EHK   4EHL   4EHN   4JJE   4JQY   4JQZ   4JR0   4PRY   4PS0   4QTX   4QTY   4QU0   4QU5   4QU8   4QU9   4QUA   4QUB   4QUD   4QUE   4QUG   4QUH   4QUI   4QUJ   4QUL   5I9B   5I9T   5IAB   5IAE   5IAG   5IAJ   5IAK   5IAN   5IAR   5IAS   5IBC   5IBP   5IBR   5IC4  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Protein-protein Interaction (2)

Gene RIF (796)

AA Sequence

MENTENSVDSKSIKNLEPKIIHGSESMDSGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVD      1 - 70
AANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKIT     71 - 140
NFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETDSGVDDDMACHKIPVEADFLYAYSTAPGYYSWRNSK    141 - 210
DGSWFIQSLCAMLKQYADKLEFMHILTRVNRKVATEFESFSFDATFHAKKQIPCIVSMLTKELYFYH       211 - 277
//

Text Mined References (942)

PMID Year Title