Property Summary

NCBI Gene PubMed Count 50
PubMed Score 93.78
PubTator Score 59.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
acute myeloid leukemia -1.700 4.2e-02
astrocytic glioma -1.200 4.6e-02
Breast cancer -1.100 2.9e-03
ependymoma 1.200 1.8e-02
group 3 medulloblastoma 1.500 5.4e-03
intraductal papillary-mucinous adenoma (... 2.700 1.7e-03
intraductal papillary-mucinous carcinoma... 2.500 7.4e-03
malignant mesothelioma -1.900 3.2e-06
oligodendroglioma 1.500 3.9e-03
ovarian cancer -3.000 4.4e-08
pituitary cancer 1.400 3.2e-07
progressive supranuclear palsy 1.600 5.6e-03
psoriasis -1.300 2.1e-03
sarcoidosis -1.100 2.5e-03
ulcerative colitis -1.048 8.4e-04

Gene RIF (37)

AA Sequence

MASSCAVQVKLELGHRAQVRKKPTVEGFTHDWMVFVRGPEHSNIQHFVEKVVFHLHESFPRPKRVCKDPP      1 - 70
YKVEESGYAGFILPIEVYFKNKEEPRKVRFDYDLFLHLEGHPPVNHLRCEKLTFNNPTEDFRRKLLKAGG     71 - 140
DPNRSIHTSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSTSFSKPHKLMKEHKEKPSKD    141 - 210
SREHKSAFKEPSRDHNKSSKESSKKPKENKPLKEEKIVPKMAFKEPKPMSKEPKPDSNLLTITSGQDKKA    211 - 280
PSKRPPISDSEELSAKKRKKSSSEALFKSFSSAPPLILTCSADKKQIKDKSHVKMGKVKIESETSEKKKS    281 - 350
TLPPFDDIVDPNDSDVEENISSKSDSEQPSPASSSSSSSSSFTPSQTRQQGPLRSIMKDLHSDDNEEESD    351 - 420
EVEDNDNDSEMERPVNRGGSRSRRVSLSDGSDSESSSASSPLHHEPPPPLLKTNNNQILEVKSPIKQSKS    421 - 490
DKQIKNGECDKAYLDELVELHRRLMTLRERHILQQIVNLIEETGHFHITNTTFDFDLCSLDKTTVRKLQS    491 - 560
YLETSGTS                                                                  561 - 568
//

Text Mined References (66)

PMID Year Title