Property Summary

NCBI Gene PubMed Count 42
Grant Count 69
R01 Count 41
Funding $6,556,915.32
PubMed Score 88.87
PubTator Score 59.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma -1.900 0.000
astrocytic glioma -1.200 0.046
ependymoma 1.200 0.018
oligodendroglioma 1.500 0.004
psoriasis -1.300 0.002
group 4 medulloblastoma 3.200 0.000
ulcerative colitis -1.048 0.001
intraductal papillary-mucinous adenoma (... 2.700 0.002
intraductal papillary-mucinous carcinoma... 2.500 0.007
progressive supranuclear palsy 1.600 0.006
Breast cancer -1.100 0.003
acute myeloid leukemia -1.700 0.042
ovarian cancer -3.000 0.000
pituitary cancer 1.400 0.000
sarcoidosis -1.100 0.003

Synonym

Accession P42568 B1AMQ2 B2R7B3 B7Z755 D3DRJ8 Q8IVB0
Symbols AF9
YEATS3

Gene

PDB

2LM0   2MV7   2N4Q   2NDF   2NDG   4TMP   5HJB   5HJD  

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
651704 screening 1633 / 1491 / 345094 Inhibition of the MLL-AF4-AF9 Interaction in Pediatric Leukemia Measured in Biochemical System Using Plate Reader - 2160-01_Inhibitor_SinglePoint_HTS_Activity
651715 summary 0 / 0 / 0 Broad Institute Inhibition of the MLL-AF4-AF9 Interaction in Pediatric Leukemia Inhibitor Probe Project
720495 confirmatory 306 / 19 / 209 Inhibition of the MLL-AF4-AF9 Interaction in Pediatric Leukemia Measured in Biochemical System Using Plate Reader - 2160-01_Inhibitor_Dose_CherryPick_Activity

Gene RIF (30)

PMID Text
25509985 AF9 and its homolog ENL directly interact with AF4.
25417107 Studies identified the evolutionarily conserved Af9 YEATS domain as a novel acetyllysine-binding module and established a direct link between histone acetylation and DOT1L-mediated H3K79 methylation in transcription control.
24565118 HIV-1 Tat forms at least two distinct P-TEFb-containing complexes. Tatcom1 is composed of P-TEFb, AF9, ENL, ELL, AFF1, AFF4, and PAF1, presenting strong CTD-kinase activity, while Tatcom2 consists of 7SK, LARP7, and MEPCE with two molecules of Tat/P-TEFb
23891621 Interaction with CBX8 precludes AF9-DOT1L binding.
23624644 Abrogation of Rac1 signaling causes DNA double-strand breaks in acute monocytic leukemia cells harbouring the MLL-AF9 oncogene.
23518577 HIV-1 Tat forms at least two distinct P-TEFb-containing complexes. Tatcom1 is composed of P-TEFb, AF9, ENL, ELL, AFF1, AFF4, and PAF1, presenting strong CTD-kinase activity, while Tatcom2 consists of 7SK, LARP7, and MEPCE with two molecules of Tat/P-TEFb
23403462 We demonstrate that leukemogenic activity of MLL-AF9 requires RUVBL2 (RuvB-like 2), an AAA+ ATPase family member that functions in a wide range of cellular processes, including chromatin remodeling and transcriptional regulation.
23260655 AF9 functions as a signaling hub that regulates transcription through dynamic recruitment of cofactors in normal hematopoiesis and in acute leukemia.
23178754 neonatal cells expressing MLL-AF9 were enriched for gene signatures associated with poor prognosis
22567366 HIV-1 Tat forms at least two distinct P-TEFb-containing complexes. Tatcom1 is composed of P-TEFb, AF9, ENL, ELL, AFF1, AFF4, and PAF1, presenting strong CTD-kinase activity, while Tatcom2 consists of 7SK, LARP7, and MEPCE with two molecules of Tat/P-TEFb
More...

AA Sequence

MASSCAVQVKLELGHRAQVRKKPTVEGFTHDWMVFVRGPEHSNIQHFVEKVVFHLHESFPRPKRVCKDPP      1 - 70
YKVEESGYAGFILPIEVYFKNKEEPRKVRFDYDLFLHLEGHPPVNHLRCEKLTFNNPTEDFRRKLLKAGG     71 - 140
DPNRSIHTSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSTSFSKPHKLMKEHKEKPSKD    141 - 210
SREHKSAFKEPSRDHNKSSKESSKKPKENKPLKEEKIVPKMAFKEPKPMSKEPKPDSNLLTITSGQDKKA    211 - 280
PSKRPPISDSEELSAKKRKKSSSEALFKSFSSAPPLILTCSADKKQIKDKSHVKMGKVKIESETSEKKKS    281 - 350
TLPPFDDIVDPNDSDVEENISSKSDSEQPSPASSSSSSSSSFTPSQTRQQGPLRSIMKDLHSDDNEEESD    351 - 420
EVEDNDNDSEMERPVNRGGSRSRRVSLSDGSDSESSSASSPLHHEPPPPLLKTNNNQILEVKSPIKQSKS    421 - 490
DKQIKNGECDKAYLDELVELHRRLMTLRERHILQQIVNLIEETGHFHITNTTFDFDLCSLDKTTVRKLQS    491 - 560
YLETSGTS                                                                  561 - 568
//

Text Mined References (56)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25509985 2014 An AF9/ENL-targted peptide with therapeutic potential in mixed lineage leukemias.
25417107 2014 AF9 YEATS domain links histone acetylation to DOT1L-mediated H3K79 methylation.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
23891621 2013 CBX8, a component of the Polycomb PRC1 complex, modulates DOT1L-mediated gene expression through AF9/MLLT3.
23624644 2013 Rac1 signaling protects monocytic AML cells expressing the MLL-AF9 oncogene from caspase-mediated apoptotic death.
23403462 2013 The AAA+ ATPase RUVBL2 is a critical mediator of MLL-AF9 oncogenesis.
23260655 2013 Leukemia fusion target AF9 is an intrinsically disordered transcriptional regulator that recruits multiple partners via coupled folding and binding.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...