Property Summary

NCBI Gene PubMed Count 42
PubMed Score 88.87
PubTator Score 59.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count P-value
group 4 medulloblastoma 1875 2.27239152668532E-8
ovarian cancer 8492 4.44162332021224E-8
pituitary cancer 1972 3.24789075793251E-7
malignant mesothelioma 3163 3.23822238305477E-6
ulcerative colitis 2087 8.44917112292493E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00168137414042229
psoriasis 6685 0.00207234689881814
sarcoidosis 368 0.00253627379450723
Breast cancer 3099 0.00292652465731643
oligodendroglioma 2849 0.0038607032276478
progressive supranuclear palsy 674 0.00556017100723865
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00736689372047918
ependymoma 2514 0.0183237487877567
acute myeloid leukemia 785 0.042179367758716
astrocytic glioma 2241 0.0455608594531281
Disease Target Count Z-score Confidence
Rheumatoid Arthritis 1171 0.0 1.0
Disease Target Count Z-score Confidence
Cancer 2346 0.0 4.0
Disease Target Count Z-score Confidence
Leukemia 88 5.16 2.6

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma -1.900 0.000
astrocytic glioma -1.200 0.046
ependymoma 1.200 0.018
oligodendroglioma 1.500 0.004
psoriasis -1.300 0.002
group 4 medulloblastoma 3.200 0.000
ulcerative colitis -1.048 0.001
intraductal papillary-mucinous adenoma (... 2.700 0.002
intraductal papillary-mucinous carcinoma... 2.500 0.007
progressive supranuclear palsy 1.600 0.006
Breast cancer -1.100 0.003
acute myeloid leukemia -1.700 0.042
ovarian cancer -3.000 0.000
pituitary cancer 1.400 0.000
sarcoidosis -1.100 0.003

Synonym

Accession P42568 B1AMQ2 B2R7B3 B7Z755 D3DRJ8 Q8IVB0
Symbols AF9
YEATS3

Gene

PDB

2LM0   2MV7   2N4Q   2NDF   2NDG   4TMP   5HJB   5HJD  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
651704 screening 1633 / 1491 / 345094 Inhibition of the MLL-AF4-AF9 Interaction in Pediatric Leukemia Measured in Biochemical System Using Plate Reader - 2160-01_Inhibitor_SinglePoint_HTS_Activity
651715 summary 0 / 0 / 0 Broad Institute Inhibition of the MLL-AF4-AF9 Interaction in Pediatric Leukemia Inhibitor Probe Project
720495 confirmatory 306 / 19 / 209 Inhibition of the MLL-AF4-AF9 Interaction in Pediatric Leukemia Measured in Biochemical System Using Plate Reader - 2160-01_Inhibitor_Dose_CherryPick_Activity

Gene RIF (30)

PMID Text
25509985 AF9 and its homolog ENL directly interact with AF4.
25417107 Studies identified the evolutionarily conserved Af9 YEATS domain as a novel acetyllysine-binding module and established a direct link between histone acetylation and DOT1L-mediated H3K79 methylation in transcription control.
24565118 HIV-1 Tat forms at least two distinct P-TEFb-containing complexes. Tatcom1 is composed of P-TEFb, AF9, ENL, ELL, AFF1, AFF4, and PAF1, presenting strong CTD-kinase activity, while Tatcom2 consists of 7SK, LARP7, and MEPCE with two molecules of Tat/P-TEFb
23891621 Interaction with CBX8 precludes AF9-DOT1L binding.
23624644 Abrogation of Rac1 signaling causes DNA double-strand breaks in acute monocytic leukemia cells harbouring the MLL-AF9 oncogene.
23518577 HIV-1 Tat forms at least two distinct P-TEFb-containing complexes. Tatcom1 is composed of P-TEFb, AF9, ENL, ELL, AFF1, AFF4, and PAF1, presenting strong CTD-kinase activity, while Tatcom2 consists of 7SK, LARP7, and MEPCE with two molecules of Tat/P-TEFb
23403462 We demonstrate that leukemogenic activity of MLL-AF9 requires RUVBL2 (RuvB-like 2), an AAA+ ATPase family member that functions in a wide range of cellular processes, including chromatin remodeling and transcriptional regulation.
23260655 AF9 functions as a signaling hub that regulates transcription through dynamic recruitment of cofactors in normal hematopoiesis and in acute leukemia.
23178754 neonatal cells expressing MLL-AF9 were enriched for gene signatures associated with poor prognosis
22567366 HIV-1 Tat forms at least two distinct P-TEFb-containing complexes. Tatcom1 is composed of P-TEFb, AF9, ENL, ELL, AFF1, AFF4, and PAF1, presenting strong CTD-kinase activity, while Tatcom2 consists of 7SK, LARP7, and MEPCE with two molecules of Tat/P-TEFb
More...

AA Sequence

MASSCAVQVKLELGHRAQVRKKPTVEGFTHDWMVFVRGPEHSNIQHFVEKVVFHLHESFPRPKRVCKDPP      1 - 70
YKVEESGYAGFILPIEVYFKNKEEPRKVRFDYDLFLHLEGHPPVNHLRCEKLTFNNPTEDFRRKLLKAGG     71 - 140
DPNRSIHTSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSTSFSKPHKLMKEHKEKPSKD    141 - 210
SREHKSAFKEPSRDHNKSSKESSKKPKENKPLKEEKIVPKMAFKEPKPMSKEPKPDSNLLTITSGQDKKA    211 - 280
PSKRPPISDSEELSAKKRKKSSSEALFKSFSSAPPLILTCSADKKQIKDKSHVKMGKVKIESETSEKKKS    281 - 350
TLPPFDDIVDPNDSDVEENISSKSDSEQPSPASSSSSSSSSFTPSQTRQQGPLRSIMKDLHSDDNEEESD    351 - 420
EVEDNDNDSEMERPVNRGGSRSRRVSLSDGSDSESSSASSPLHHEPPPPLLKTNNNQILEVKSPIKQSKS    421 - 490
DKQIKNGECDKAYLDELVELHRRLMTLRERHILQQIVNLIEETGHFHITNTTFDFDLCSLDKTTVRKLQS    491 - 560
YLETSGTS                                                                  561 - 568
//

Text Mined References (56)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25509985 2014 An AF9/ENL-targted peptide with therapeutic potential in mixed lineage leukemias.
25417107 2014 AF9 YEATS domain links histone acetylation to DOT1L-mediated H3K79 methylation.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
23891621 2013 CBX8, a component of the Polycomb PRC1 complex, modulates DOT1L-mediated gene expression through AF9/MLLT3.
23624644 2013 Rac1 signaling protects monocytic AML cells expressing the MLL-AF9 oncogene from caspase-mediated apoptotic death.
23403462 2013 The AAA+ ATPase RUVBL2 is a critical mediator of MLL-AF9 oncogenesis.
23260655 2013 Leukemia fusion target AF9 is an intrinsically disordered transcriptional regulator that recruits multiple partners via coupled folding and binding.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...