Property Summary

NCBI Gene PubMed Count 82
PubMed Score 171.65
PubTator Score 110.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
non-small cell lung cancer 2798 5.97377734350977E-17
medulloblastoma 1524 1.55832176579851E-9
atypical teratoid / rhabdoid tumor 4369 2.67182357297433E-9
ovarian cancer 8492 8.37198117311918E-9
pilocytic astrocytoma 3086 1.01645063615328E-6
medulloblastoma, large-cell 6234 1.10171087750139E-6
glioblastoma 5572 2.62252850493481E-6
malignant mesothelioma 3163 4.17393541572349E-6
pituitary cancer 1972 5.50639007411363E-6
adult high grade glioma 2148 4.13884542770744E-5
lung cancer 4473 6.89040994581775E-5
dermatomyositis 967 2.02954490652227E-4
osteosarcoma 7933 3.65322001172956E-4
primitive neuroectodermal tumor 3031 9.74819080806067E-4
invasive ductal carcinoma 2950 0.00151564984740131
astrocytoma 1493 0.00450204104858582
ependymoma 2514 0.00523192703075563
Pick disease 1893 0.00932246467907694
Waldenstrons macroglobulinemia 765 0.0106253857669841
oligodendroglioma 2849 0.0205913122877983
Disease Target Count Z-score Confidence
Allergic rhinitis 92 0.0 1.0
Disease Target Count Z-score Confidence
Cancer 2346 0.0 4.0

Expression

  Differential Expression (20)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.211 0.011
malignant mesothelioma -1.200 0.000
astrocytoma -1.600 0.005
ependymoma -1.800 0.005
oligodendroglioma -1.800 0.021
glioblastoma -2.400 0.000
osteosarcoma -1.412 0.000
medulloblastoma -2.500 0.000
atypical teratoid / rhabdoid tumor -2.800 0.000
medulloblastoma, large-cell -3.200 0.000
primitive neuroectodermal tumor -1.700 0.001
non-small cell lung cancer -1.119 0.000
lung cancer -1.300 0.000
adult high grade glioma -2.200 0.000
pilocytic astrocytoma -1.800 0.000
Pick disease -1.100 0.009
invasive ductal carcinoma -1.100 0.002
ovarian cancer -2.100 0.000
pituitary cancer 1.200 0.000
dermatomyositis 1.300 0.000

Synonym

Accession P42566 B2R8J7 D3DPJ2 Q5SRH4 Protein Eps15
Symbols AF1P
AF-1P
MLLT5

Gene

PDB

2JXC   4RH5   4RH9   4RHG   4S0G   1C07   1EH2   1F8H   1FF1   2IV9   5AWT   5AWU   5JP2  

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Cow OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

 GWAS Trait (1)

Gene RIF (20)

PMID Text
26289382 over-expression of EPS15 is a potential favorable prognostic marker in breast cancer.
25496667 Genome-wide shRNA screening identifies EPS15, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
25496667 Knockdown of EPS15 by shRNA significantly inhibits HIV-1 replication in CD4+ T-cells
25260758 Ubiquitin is sufficient for Eps15 recruitment to endosomes.
24269888 Results indicate that phosphorylation of epidermal growth factor receptor pathway substrate 15 (Eps15) at Ser-796 is catalyzed by p38 directly.
24173214 Genome-wide shRNA screening identifies EPS15, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
22581003 MLL-EPS15 translocation and individual genomic copy number alterations in monozygotic infant twins are associated with acute lymphoblastic leukemia.
21832070 distinct forms of Eps15 direct EGFR to either the late endosome/lysosome for degradation (Eps15) or to the recycling endosome for transit back to the cell surface (Eps15S)
20634891 Observational study of gene-disease association. (HuGE Navigator)
20106972 analysis of the selective interaction of C-terminal Eps15 homology domain proteins with specific Asn-Pro-Phe-containing partners
More...

AA Sequence

MAAAAQLSLTQLSSGNPVYEKYYRQVDTGNTGRVLASDAAAFLKKSGLPDLILGKIWDLADTDGKGILNK      1 - 70
QEFFVALRLVACAQNGLEVSLSSLNLAVPPPRFHDTSSPLLISGTSAAELPWAVKPEDKAKYDAIFDSLS     71 - 140
PVNGFLSGDKVKPVLLNSKLPVDILGRVWELSDIDHDGMLDRDEFAVAMFLVYCALEKEPVPMSLPPALV    141 - 210
PPSKRKTWVVSPAEKAKYDEIFLKTDKDMDGFVSGLEVREIFLKTGLPSTLLAHIWSLCDTKDCGKLSKD    211 - 280
QFALAFHLISQKLIKGIDPPHVLTPEMIPPSDRASLQKNIIGSSPVADFSAIKELDTLNNEIVDLQREKN    281 - 350
NVEQDLKEKEDTIKQRTSEVQDLQDEVQRENTNLQKLQAQKQQVQELLDELDEQKAQLEEQLKEVRKKCA    351 - 420
EEAQLISSLKAELTSQESQISTYEEELAKAREELSRLQQETAELEESVESGKAQLEPLQQHLQDSQQEIS    421 - 490
SMQMKLMEMKDLENHNSQLNWCSSPHSILVNGATDYCSLSTSSSETANLNEHVEGQSNLESEPIHQESPA    491 - 560
RSSPELLPSGVTDENEVTTAVTEKVCSELDNNRHSKEEDPFNVDSSSLTGPVADTNLDFFQSDPFVGSDP    561 - 630
FKDDPFGKIDPFGGDPFKGSDPFASDCFFRQSTDPFATSSTDPFSAANNSSITSVETLKHNDPFAPGGTV    631 - 700
VAASDSATDPFASVFGNESFGGGFADFSTLSKVNNEDPFRSATSSSVSNVVITKNVFEETSVKSEDEPPA    701 - 770
LPPKIGTPTRPCPLPPGKRSINKLDSPDPFKLNDPFQPFPGNDSPKEKDPEIFCDPFTSATTTTNKEADP    771 - 840
SNFANFSAYPSEEDMIEWAKRESEREEEQRLARLNQQEQEDLELAIALSKSEISEA                  841 - 896
//

Text Mined References (101)

PMID Year Title
26289382 2015 Over-expression of EPS15 is a favorable prognostic factor in breast cancer.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25260758 2014 UIM domain-dependent recruitment of the endocytic adaptor protein Eps15 to ubiquitin-enriched endosomes.
24768539 2014 K33-Linked Polyubiquitination of Coronin 7 by Cul3-KLHL20 Ubiquitin E3 Ligase Regulates Protein Trafficking.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24269888 2014 p38-Mediated phosphorylation of Eps15 endocytic adaptor protein.
23211419 2013 Identification and selected reaction monitoring (SRM) quantification of endocytosis factors associated with Numb.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22648170 2012 The clathrin adaptor Dab2 recruits EH domain scaffold proteins to regulate integrin ?1 endocytosis.
More...