Property Summary

NCBI Gene PubMed Count 82
Grant Count 73
R01 Count 62
Funding $7,399,798.06
PubMed Score 171.65
PubTator Score 110.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.211 0.011
malignant mesothelioma -1.200 0.000
astrocytoma -1.600 0.005
ependymoma -1.800 0.005
oligodendroglioma -1.800 0.021
glioblastoma -2.400 0.000
osteosarcoma -1.412 0.000
medulloblastoma -2.500 0.000
atypical teratoid / rhabdoid tumor -2.800 0.000
medulloblastoma, large-cell -3.200 0.000
primitive neuroectodermal tumor -1.700 0.001
non-small cell lung cancer -1.119 0.000
lung cancer -1.300 0.000
adult high grade glioma -2.200 0.000
pilocytic astrocytoma -1.800 0.000
Pick disease -1.100 0.009
invasive ductal carcinoma -1.100 0.002
ovarian cancer -2.100 0.000
pituitary cancer 1.200 0.000
dermatomyositis 1.300 0.000

Synonym

Accession P42566 B2R8J7 D3DPJ2 Q5SRH4 Protein Eps15
Symbols AF1P
AF-1P
MLLT5

Gene

PDB

2JXC   4RH5   4RH9   4RHG   4S0G   1C07   1EH2   1F8H   1FF1   2IV9   5AWT   5AWU   5JP2  

 GWAS Trait (1)

Gene RIF (21)

PMID Text
26289382 over-expression of EPS15 is a potential favorable prognostic marker in breast cancer.
25496667 Genome-wide shRNA screening identifies EPS15, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
25496667 Knockdown of EPS15 by shRNA significantly inhibits HIV-1 replication in CD4+ T-cells
25260758 Ubiquitin is sufficient for Eps15 recruitment to endosomes.
24269888 Results indicate that phosphorylation of epidermal growth factor receptor pathway substrate 15 (Eps15) at Ser-796 is catalyzed by p38 directly.
24173214 Genome-wide shRNA screening identifies EPS15, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
24173214 Genome-wide shRNA screening identifies EPS15, which is required for HIV-1 Nef-induced downregulation of CD4 in HeLa CD4+ cells
22581003 MLL-EPS15 translocation and individual genomic copy number alterations in monozygotic infant twins are associated with acute lymphoblastic leukemia.
21832070 distinct forms of Eps15 direct EGFR to either the late endosome/lysosome for degradation (Eps15) or to the recycling endosome for transit back to the cell surface (Eps15S)
20634891 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MAAAAQLSLTQLSSGNPVYEKYYRQVDTGNTGRVLASDAAAFLKKSGLPDLILGKIWDLADTDGKGILNK      1 - 70
QEFFVALRLVACAQNGLEVSLSSLNLAVPPPRFHDTSSPLLISGTSAAELPWAVKPEDKAKYDAIFDSLS     71 - 140
PVNGFLSGDKVKPVLLNSKLPVDILGRVWELSDIDHDGMLDRDEFAVAMFLVYCALEKEPVPMSLPPALV    141 - 210
PPSKRKTWVVSPAEKAKYDEIFLKTDKDMDGFVSGLEVREIFLKTGLPSTLLAHIWSLCDTKDCGKLSKD    211 - 280
QFALAFHLISQKLIKGIDPPHVLTPEMIPPSDRASLQKNIIGSSPVADFSAIKELDTLNNEIVDLQREKN    281 - 350
NVEQDLKEKEDTIKQRTSEVQDLQDEVQRENTNLQKLQAQKQQVQELLDELDEQKAQLEEQLKEVRKKCA    351 - 420
EEAQLISSLKAELTSQESQISTYEEELAKAREELSRLQQETAELEESVESGKAQLEPLQQHLQDSQQEIS    421 - 490
SMQMKLMEMKDLENHNSQLNWCSSPHSILVNGATDYCSLSTSSSETANLNEHVEGQSNLESEPIHQESPA    491 - 560
RSSPELLPSGVTDENEVTTAVTEKVCSELDNNRHSKEEDPFNVDSSSLTGPVADTNLDFFQSDPFVGSDP    561 - 630
FKDDPFGKIDPFGGDPFKGSDPFASDCFFRQSTDPFATSSTDPFSAANNSSITSVETLKHNDPFAPGGTV    631 - 700
VAASDSATDPFASVFGNESFGGGFADFSTLSKVNNEDPFRSATSSSVSNVVITKNVFEETSVKSEDEPPA    701 - 770
LPPKIGTPTRPCPLPPGKRSINKLDSPDPFKLNDPFQPFPGNDSPKEKDPEIFCDPFTSATTTTNKEADP    771 - 840
SNFANFSAYPSEEDMIEWAKRESEREEEQRLARLNQQEQEDLELAIALSKSEISEA                  841 - 896
//

Text Mined References (101)

PMID Year Title
26289382 2015 Over-expression of EPS15 is a favorable prognostic factor in breast cancer.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25260758 2014 UIM domain-dependent recruitment of the endocytic adaptor protein Eps15 to ubiquitin-enriched endosomes.
24768539 2014 K33-Linked Polyubiquitination of Coronin 7 by Cul3-KLHL20 Ubiquitin E3 Ligase Regulates Protein Trafficking.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24269888 2014 p38-Mediated phosphorylation of Eps15 endocytic adaptor protein.
23211419 2013 Identification and selected reaction monitoring (SRM) quantification of endocytosis factors associated with Numb.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22648170 2012 The clathrin adaptor Dab2 recruits EH domain scaffold proteins to regulate integrin ?1 endocytosis.
More...