Property Summary

NCBI Gene PubMed Count 88
PubMed Score 174.51
PubTator Score 110.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
adult high grade glioma -2.200 4.1e-05
astrocytic glioma -1.400 1.5e-02
Astrocytoma, Pilocytic -1.800 1.1e-06
atypical teratoid / rhabdoid tumor -2.800 2.7e-09
dermatomyositis 1.300 2.0e-04
ependymoma -1.800 5.2e-03
glioblastoma -1.900 1.1e-07
group 3 medulloblastoma -2.200 7.7e-04
invasive ductal carcinoma -1.100 1.5e-03
lung cancer -1.300 6.9e-05
malignant mesothelioma -1.200 4.2e-06
medulloblastoma, large-cell -3.200 1.1e-06
non-small cell lung cancer -1.119 6.0e-17
oligodendroglioma -1.800 2.1e-02
osteosarcoma -1.412 3.7e-04
ovarian cancer -2.100 8.4e-09
Pick disease -1.100 9.3e-03
pituitary cancer 1.200 5.5e-06
primitive neuroectodermal tumor -1.700 9.7e-04
Waldenstrons macroglobulinemia 1.211 1.1e-02

 GWAS Trait (1)

Protein-protein Interaction (2)

PDB (13)

Gene RIF (25)

AA Sequence

MAAAAQLSLTQLSSGNPVYEKYYRQVDTGNTGRVLASDAAAFLKKSGLPDLILGKIWDLADTDGKGILNK      1 - 70
QEFFVALRLVACAQNGLEVSLSSLNLAVPPPRFHDTSSPLLISGTSAAELPWAVKPEDKAKYDAIFDSLS     71 - 140
PVNGFLSGDKVKPVLLNSKLPVDILGRVWELSDIDHDGMLDRDEFAVAMFLVYCALEKEPVPMSLPPALV    141 - 210
PPSKRKTWVVSPAEKAKYDEIFLKTDKDMDGFVSGLEVREIFLKTGLPSTLLAHIWSLCDTKDCGKLSKD    211 - 280
QFALAFHLISQKLIKGIDPPHVLTPEMIPPSDRASLQKNIIGSSPVADFSAIKELDTLNNEIVDLQREKN    281 - 350
NVEQDLKEKEDTIKQRTSEVQDLQDEVQRENTNLQKLQAQKQQVQELLDELDEQKAQLEEQLKEVRKKCA    351 - 420
EEAQLISSLKAELTSQESQISTYEEELAKAREELSRLQQETAELEESVESGKAQLEPLQQHLQDSQQEIS    421 - 490
SMQMKLMEMKDLENHNSQLNWCSSPHSILVNGATDYCSLSTSSSETANLNEHVEGQSNLESEPIHQESPA    491 - 560
RSSPELLPSGVTDENEVTTAVTEKVCSELDNNRHSKEEDPFNVDSSSLTGPVADTNLDFFQSDPFVGSDP    561 - 630
FKDDPFGKIDPFGGDPFKGSDPFASDCFFRQSTDPFATSSTDPFSAANNSSITSVETLKHNDPFAPGGTV    631 - 700
VAASDSATDPFASVFGNESFGGGFADFSTLSKVNNEDPFRSATSSSVSNVVITKNVFEETSVKSEDEPPA    701 - 770
LPPKIGTPTRPCPLPPGKRSINKLDSPDPFKLNDPFQPFPGNDSPKEKDPEIFCDPFTSATTTTNKEADP    771 - 840
SNFANFSAYPSEEDMIEWAKRESEREEEQRLARLNQQEQEDLELAIALSKSEISEA                  841 - 896
//

Text Mined References (108)

PMID Year Title