Property Summary

NCBI Gene PubMed Count 11
PubMed Score 102.11
PubTator Score 271.54

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma 1.300 4.9e-04
cystic fibrosis 2.100 1.3e-04
Endometriosis -1.341 1.8e-02
interstitial lung disease -1.100 4.3e-02
lung cancer -2.400 1.9e-04
medulloblastoma, large-cell 1.200 5.1e-04
non primary Sjogren syndrome sicca -1.100 2.3e-02
osteosarcoma -3.895 2.1e-05
ovarian cancer 1.300 2.9e-06
pituitary cancer -3.300 5.5e-07
psoriasis 2.700 1.3e-08
tuberculosis 2.100 1.2e-05

 OMIM Phenotype (1)

 GWAS Trait (1)

Protein-protein Interaction (2)

Gene RIF (6)

AA Sequence

MPRYTVHVRGEWLAVPCQDAQLTVGWLGREAVRRYIKNKPDNGGFTSVDDAHFLVRRCKGLGLLDNEDRL      1 - 70
EVALENNEFVEVVIEGDAMSPDFIPSQPEGVYLYSKYREPEKYIELDGDRLTTEDLVNLGKGRYKIKLTP     71 - 140
TAEKRVQKSREVIDSIIKEKTVVYGITTGFGKFARTVIPINKLQELQVNLVRSHSSGVGKPLSPERCRML    141 - 210
LALRINVLAKGYSGISLETLKQVIEMFNASCLPYVPEKGTVGASGDLAPLSHLALGLVGEGKMWSPKSGW    211 - 280
ADAKYVLEAHGLKPVILKPKEGLALINGTQMITSLGCEAVERASAIARQADIVAALTLEVLKGTTKAFDT    281 - 350
DIHALRPHRGQIEVAFRFRSLLDSDHHPSEIAESHRFCDRVQDAYTLRCCPQVHGVVNDTIAFVKNIITT    351 - 420
ELNSATDNPMVFANRGETVSGGNFHGEYPAKALDYLAIGIHELAAISERRIERLCNPSLSELPAFLVAEG    421 - 490
GLNSGFMIAHCTAAALVSENKALCHPSSVDSLSTSAATEDHVSMGGWAARKALRVIEHVEQVLAIELLAA    491 - 560
CQGIEFLRPLKTTTPLEKVYDLVRSVVRPWIKDRFMAPDIEAAHRLLLEQKVWEVAAPYIEKYRMEHIPE    561 - 630
SRPLSPTAFSLQFLHKKSTKIPESEDL                                               631 - 657
//

Text Mined References (14)

PMID Year Title