Property Summary

NCBI Gene PubMed Count 63
PubMed Score 27.25
PubTator Score 32.30

Knowledge Summary

Patent (5,637)

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma 1.200 0.000
astrocytoma -1.400 0.000
glioblastoma -2.100 0.000
oligodendroglioma -1.400 0.000
osteosarcoma -1.603 0.000
ependymoma -1.900 0.000
atypical teratoid / rhabdoid tumor -2.300 0.000
sonic hedgehog group medulloblastoma -1.200 0.002
medulloblastoma, large-cell -1.700 0.000
primitive neuroectodermal tumor -1.400 0.000
pediatric high grade glioma -2.000 0.000
pilocytic astrocytoma -2.000 0.000
Pick disease -1.400 0.014
acute myeloid leukemia 1.200 0.003
ovarian cancer 2.000 0.000

Synonym

Accession P42356 Q7Z625 Q9UPG2 PI4-kinase alpha
Symbols PIK4CA
PMGYCHA
pi4K230
PI4K-ALPHA

Gene

PANTHER Protein Class (2)

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

 Collection (1)

Gene RIF (41)

PMID Text
25886792 PI4K III alpha plays a role in biosynthetic trafficking of two different classes of proteins from the ER to the Golgi complex.
25855803 Missense mutations in PI4KA are associated with perisylvian polymicrogyria, cerebellar hypoplasia and arthrogryposis.
25608530 Our results suggest a plasticity of the molecular interactions that control PI4KIIIalpha localization and functions at the plasma membrane.
25209194 PI4KA and GRM3 polymorphisms have potential to jointly modulate antipsychotic response
25168678 our results suggest a mechanism of PI4K IIalpha recruitment, regulation, and function at the membrane.
24920820 The N-terminal 1,152 amino acids were dispensable for hepatitis C virus replication, phosphatidylinositol 4-phosphate induction, and enzymatic function, thereby defining the minimal PI4KIIIalpha core enzyme at a size of ca. 108 kDa.
24671493 These results suggest that type II PtdIns 4-kinases are part of piperine-mediated anti-inflammatory signaling mechanisms
24415756 PI4KA is essential for the maintenance of plasma membrane phosphatidylinositol 4,5-bisphosphate pools but only during strong stimulation of receptors coupled to phospholipase C activation.
24393405 PI4KA mRNA could be used as a new molecular marker to improve established prognostic models for hepatocellular carcinoma.
24077433 Descriptive Statement The genetic interactions associated with ILVatrophy rate in this study may be mapping variants inSYNJ2andPI4KAthat interact to decrease synthesisof PIP.
More...

AA Sequence

MAAAPARGGGGGGGGGGGCSGSGSSASRGFYFNTVLSLARSLAVQRPASLEKVQKLLCMCPVDFHGIFQL      1 - 70
DERRRDAVIALGIFLIESDLQHKDCVVPYLLRLLKGLPKVYWVEESTARKGRGALPVAESFSFCLVTLLS     71 - 140
DVAYRDPSLRDEILEVLLQVLHVLLGMCQALEIQDKEYLCKYAIPCLIGISRAFGRYSNMEESLLSKLFP    141 - 210
KIPPHSLRVLEELEGVRRRSFNDFRSILPSNLLTVCQEGTLKRKTSSVSSISQVSPERGMPPPSSPGGSA    211 - 280
FHYFEASCLPDGTALEPEYYFSTISSSFSVSPLFNGVTYKEFNIPLEMLRELLNLVKKIVEEAVLKSLDA    281 - 350
IVASVMEANPSADLYYTSFSDPLYLTMFKMLRDTLYYMKDLPTSFVKEIHDFVLEQFNTSQGELQKILHD    351 - 420
ADRIHNELSPLKLRCQANAACVDLMVWAVKDEQGAENLCIKLSEKLQSKTSSKVIIAHLPLLICCLQGLG    421 - 490
RLCERFPVVVHSVTPSLRDFLVIPSPVLVKLYKYHSQYHTVAGNDIKISVTNEHSESTLNVMSGKKSQPS    491 - 560
MYEQLRDIAIDNICRCLKAGLTVDPVIVEAFLASLSNRLYISQESDKDAHLIPDHTIRALGHIAVALRDT    561 - 630
PKVMEPILQILQQKFCQPPSPLDVLIIDQLGCLVITGNQYIYQEVWNLFQQISVKASSVVYSATKDYKDH    631 - 700
GYRHCSLAVINALANIAANIQDEHLVDELLMNLLELFVQLGLEGKRASERASEKGPALKASSSAGNLGVL    701 - 770
IPVIAVLTRRLPPIKEAKPRLQKLFRDFWLYSVLMGFAVEGSGLWPEEWYEGVCEIATKSPLLTFPSKEP    771 - 840
LRSVLQYNSAMKNDTVTPAELSELRSTIINLLDPPPEVSALINKLDFAMSTYLLSVYRLEYMRVLRSTDP    841 - 910
DRFQVMFCYFEDKAIQKDKSGMMQCVIAVADKVFDAFLNMMADKAKTKENEEELERHAQFLLVNFNHIHK    911 - 980
RIRRVADKYLSGLVDKFPHLLWSGTVLKTMLDILQTLSLSLSADIHKDQPYYDIPDAPYRITVPDTYEAR    981 - 1050
ESIVKDFAARCGMILQEAMKWAPTVTKSHLQEYLNKHQNWVSGLSQHTGLAMATESILHFAGYNKQNTTL   1051 - 1120
GATQLSERPACVKKDYSNFMASLNLRNRYAGEVYGMIRFSGTTGQMSDLNKMMVQDLHSALDRSHPQHYT   1121 - 1190
QAMFKLTAMLISSKDCDPQLLHHLCWGPLRMFNEHGMETALACWEWLLAGKDGVEVPFMREMAGAWHMTV   1191 - 1260
EQKFGLFSAEIKEADPLAASEASQPKPCPPEVTPHYIWIDFLVQRFEIAKYCSSDQVEIFSSLLQRSMSL   1261 - 1330
NIGGAKGSMNRHVAAIGPRFKLLTLGLSLLHADVVPNATIRNVLREKIYSTAFDYFSCPPKFPTQGEKRL   1331 - 1400
REDISIMIKFWTAMFSDKKYLTASQLVPPDNQDTRSNLDITVGSRQQATQGWINTYPLSSGMSTISKKSG   1401 - 1470
MSKKTNRGSQLHKYYMKRRTLLLSLLATEIERLITWYNPLSAPELELDQAGENSVANWRSKYISLSEKQW   1471 - 1540
KDNVNLAWSISPYLAVQLPARFKNTEAIGNEVTRLVRLDPGAVSDVPEAIKFLVTWHTIDADAPELSHVL   1541 - 1610
CWAPTDPPTGLSYFSSMYPPHPLTAQYGVKVLRSFPPDAILFYIPQIVQALRYDKMGYVREYILWAASKS   1611 - 1680
QLLAHQFIWNMKTNIYLDEEGHQKDPDIGDLLDQLVEEITGSLSGPAKDFYQREFDFFNKITNVSAIIKP   1681 - 1750
YPKGDERKKACLSALSEVKVQPGCYLPSNPEAIVLDIDYKSGTPMQSAAKAPYLAKFKVKRCGVSELEKE   1751 - 1820
GLRCRSDSEDECSTQEADGQKISWQAAIFKVGDDCRQDMLALQIIDLFKNIFQLVGLDLFVFPYRVVATA   1821 - 1890
PGCGVIECIPDCTSRDQLGRQTDFGMYDYFTRQYGDESTLAFQQARYNFIRSMAAYSLLLFLLQIKDRHN   1891 - 1960
GNIMLDKKGHIIHIDFGFMFESSPGGNLGWEPDIKLTDEMVMIMGGKMEATPFKWFMEMCVRGYLAVRPY   1961 - 2030
MDAVVSLVTLMLDTGLPCFRGQTIKLLKHRFSPNMTEREAANFIMKVIQSCFLSNRSRTYDMIQYYQNDI   2031 - 2100
PY                                                                       2101 - 2102
//

Text Mined References (72)

PMID Year Title
26571211 2016 The leukodystrophy protein FAM126A (hyccin) regulates PtdIns(4)P synthesis at the plasma membrane.
25886792 2015 A novel fluorescence-based biosynthetic trafficking method provides pharmacologic evidence that PI4-kinase III? is important for protein trafficking from the endoplasmic reticulum to the plasma membrane.
25855803 2015 Germline recessive mutations in PI4KA are associated with perisylvian polymicrogyria, cerebellar hypoplasia and arthrogryposis.
25608530 2015 Plasticity of PI4KIII? interactions at the plasma membrane.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25327288 2014 Selective VPS34 inhibitor blocks autophagy and uncovers a role for NCOA4 in ferritin degradation and iron homeostasis in vivo.
25209194 2014 Synergistic association of PI4KA and GRM3 genetic polymorphisms with poor antipsychotic response in south Indian schizophrenia patients with low severity of illness.
25168678 2014 The crystal structure of the phosphatidylinositol 4-kinase II?.
24920820 2014 Mapping of functional domains of the lipid kinase phosphatidylinositol 4-kinase type III alpha involved in enzymatic activity and hepatitis C virus replication.
24671493 2014 Piperine inhibits type II phosphatidylinositol 4-kinases: a key component in phosphoinositides turnover.
More...