Property Summary

NCBI Gene PubMed Count 63
PubMed Score 27.25
PubTator Score 32.30

Knowledge Summary

Patent (5,637)

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma 1.200 2.6e-06
astrocytoma -1.400 4.8e-21
glioblastoma -2.100 1.2e-06
oligodendroglioma -1.400 1.2e-16
osteosarcoma -1.603 2.4e-05
ependymoma -1.900 5.7e-15
atypical teratoid / rhabdoid tumor -2.300 5.6e-09
sonic hedgehog group medulloblastoma -1.200 1.7e-03
medulloblastoma, large-cell -1.700 3.4e-05
primitive neuroectodermal tumor -1.400 5.1e-05
pediatric high grade glioma -2.000 2.3e-07
pilocytic astrocytoma -2.000 4.8e-09
Pick disease -1.400 1.4e-02
acute myeloid leukemia 1.200 3.5e-03
ovarian cancer 2.000 1.6e-06

Gene RIF (41)

PMID Text
25886792 PI4K III alpha plays a role in biosynthetic trafficking of two different classes of proteins from the ER to the Golgi complex.
25855803 Missense mutations in PI4KA are associated with perisylvian polymicrogyria, cerebellar hypoplasia and arthrogryposis.
25608530 Our results suggest a plasticity of the molecular interactions that control PI4KIIIalpha localization and functions at the plasma membrane.
25209194 PI4KA and GRM3 polymorphisms have potential to jointly modulate antipsychotic response
25168678 our results suggest a mechanism of PI4K IIalpha recruitment, regulation, and function at the membrane.
24920820 The N-terminal 1,152 amino acids were dispensable for hepatitis C virus replication, phosphatidylinositol 4-phosphate induction, and enzymatic function, thereby defining the minimal PI4KIIIalpha core enzyme at a size of ca. 108 kDa.
24671493 These results suggest that type II PtdIns 4-kinases are part of piperine-mediated anti-inflammatory signaling mechanisms
24415756 PI4KA is essential for the maintenance of plasma membrane phosphatidylinositol 4,5-bisphosphate pools but only during strong stimulation of receptors coupled to phospholipase C activation.
24393405 PI4KA mRNA could be used as a new molecular marker to improve established prognostic models for hepatocellular carcinoma.
24077433 Descriptive Statement The genetic interactions associated with ILVatrophy rate in this study may be mapping variants inSYNJ2andPI4KAthat interact to decrease synthesisof PIP.
23675303 we demonstrate that PI4KIIIalpha activity affects the NS5A phosphorylation status.
22896614 Cell culture studies with Phosphatidylinositol-4-kinase IIIalpha inhibitors demonstrated that the kinase activity was essential for hepatitis C virus RNA replication.
22535966 Phosphatidylinositol 4-kinase IIalpha is palmitoylated by Golgi-localized palmitoyltransferases in cholesterol-dependent manner
22022594 PI4KA is necessary for the local enrichment of PI 4-phosphate at the hepatitis c virus membranous web.
21697487 These results suggest that hepatitis C virus NS5A modulation of PI4KA-dependent phosphatidylinositol 4-phosphate production influences replication complex formation.
21601653 confirmed the high copy number of PI4KIIIalpha transcript in K562 cells along with several genes located in the same region in Chr22, including two pseudogenes that cover most exons coding for isoform 1, consistent with chromosome amplification
21330372 Study identify the molecular chaperone Hsp90 as a binding partner of PI4KIIbeta, but not of PI4KIIalpha.
21297162 PI4KIIIalpha is an essential host factor that supports HCV proliferation and therefore PI4KIIIalpha may be a legitimate target for anti-HCV therapy.
21238945 This analysis suggests that the direct activation of a lipid kinase PI4KA by hepatitis C virus NS5A contributes critically to the integrity of the membranous viral replication complex.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20530568 Data suggest that Rab1 contributes to the specificity and timing of GBF1 recruitment by activating PI4KIIIalpha, and that the PtdIns(4)P produced then allows GBF1 to bind to Golgi membranes and activate Arf1.
20052689 No strong association between PIK4CA and psychosis in people with 22q11.2 deletion syndrome
19913121 Observational study of gene-disease association. (HuGE Navigator)
19608626 our library screening completed data on the clathrin-mediated endocytosis-dependant entry route of HCV and identified 2 kinases, PI4KIIIalpha and beta, as relevant potential therapeutic targets.
19605471 genetic or pharmacological modulation of PI4KA and PI4KB inhibits multiple genotypes of HCV
19304308 the PI4KA gene was shown to be essential for the replication of all HCV genotypes tested
18646052 Association of the PIK4CA schizophrenia-susceptibility gene in adults with the 22q11.2 deletion syndrome is reported.
18646052 Observational study of gene-disease association. (HuGE Navigator)
18615484 Failure to confirm the association between the PIK4CA gene and schizophrenia in a Japanese population is reported.
18585705 The putative bipartite nuclear localization signal(NLS) itself is a nucleolar targeting signal, and for nuclear import PI4K230 requires a larger sequence around it or, alternatively, the monopartite NLS.
18521859 The present study suggests that the PIK4CA gene does not play a significant role in the vulnerability to METH use disorder in the Japanese population.
18521859 Observational study of gene-disease association. (HuGE Navigator)
18077555 These results indicate that a small fraction of the cellular PI4K activity is sufficient to maintain plasma membrane phosphoinositide pools.
17893707 The PIK4CA gene is located in the chromosome 22q11 deletion syndrome region, which is of particular interest because it has been implicated in schizophrenia.
17893707 Observational study of gene-disease association. (HuGE Navigator)
17555516 PI4KIIalpha or PI4KIIbeta knockdown, but not type III PI4Kbeta knockdown, inhibits Listeria internalization.
17131383 These experiments suggest the participation of PI4K230 in a DNase and RNase sensitive complex with a unique localization and function in the nucleolus.
16606619 nuclear phosphatidylinositol 4-phosphate, and consequently, synthesis of polyphosphoinositides are required for a correct nuclear function
15634669 PI4KIIIbeta (PIK4CB) and PI4KIIalpha (PIK4CA) localize to discrete subcompartments of the Golgi complex in Madin-Darby canine kidney (MDCK) cells.
12497619 Observational study of gene-disease association. (HuGE Navigator)
11907035 parallel activation by extracellular calcium-sensing receptor

AA Sequence

MAAAPARGGGGGGGGGGGCSGSGSSASRGFYFNTVLSLARSLAVQRPASLEKVQKLLCMCPVDFHGIFQL      1 - 70
DERRRDAVIALGIFLIESDLQHKDCVVPYLLRLLKGLPKVYWVEESTARKGRGALPVAESFSFCLVTLLS     71 - 140
DVAYRDPSLRDEILEVLLQVLHVLLGMCQALEIQDKEYLCKYAIPCLIGISRAFGRYSNMEESLLSKLFP    141 - 210
KIPPHSLRVLEELEGVRRRSFNDFRSILPSNLLTVCQEGTLKRKTSSVSSISQVSPERGMPPPSSPGGSA    211 - 280
FHYFEASCLPDGTALEPEYYFSTISSSFSVSPLFNGVTYKEFNIPLEMLRELLNLVKKIVEEAVLKSLDA    281 - 350
IVASVMEANPSADLYYTSFSDPLYLTMFKMLRDTLYYMKDLPTSFVKEIHDFVLEQFNTSQGELQKILHD    351 - 420
ADRIHNELSPLKLRCQANAACVDLMVWAVKDEQGAENLCIKLSEKLQSKTSSKVIIAHLPLLICCLQGLG    421 - 490
RLCERFPVVVHSVTPSLRDFLVIPSPVLVKLYKYHSQYHTVAGNDIKISVTNEHSESTLNVMSGKKSQPS    491 - 560
MYEQLRDIAIDNICRCLKAGLTVDPVIVEAFLASLSNRLYISQESDKDAHLIPDHTIRALGHIAVALRDT    561 - 630
PKVMEPILQILQQKFCQPPSPLDVLIIDQLGCLVITGNQYIYQEVWNLFQQISVKASSVVYSATKDYKDH    631 - 700
GYRHCSLAVINALANIAANIQDEHLVDELLMNLLELFVQLGLEGKRASERASEKGPALKASSSAGNLGVL    701 - 770
IPVIAVLTRRLPPIKEAKPRLQKLFRDFWLYSVLMGFAVEGSGLWPEEWYEGVCEIATKSPLLTFPSKEP    771 - 840
LRSVLQYNSAMKNDTVTPAELSELRSTIINLLDPPPEVSALINKLDFAMSTYLLSVYRLEYMRVLRSTDP    841 - 910
DRFQVMFCYFEDKAIQKDKSGMMQCVIAVADKVFDAFLNMMADKAKTKENEEELERHAQFLLVNFNHIHK    911 - 980
RIRRVADKYLSGLVDKFPHLLWSGTVLKTMLDILQTLSLSLSADIHKDQPYYDIPDAPYRITVPDTYEAR    981 - 1050
ESIVKDFAARCGMILQEAMKWAPTVTKSHLQEYLNKHQNWVSGLSQHTGLAMATESILHFAGYNKQNTTL   1051 - 1120
GATQLSERPACVKKDYSNFMASLNLRNRYAGEVYGMIRFSGTTGQMSDLNKMMVQDLHSALDRSHPQHYT   1121 - 1190
QAMFKLTAMLISSKDCDPQLLHHLCWGPLRMFNEHGMETALACWEWLLAGKDGVEVPFMREMAGAWHMTV   1191 - 1260
EQKFGLFSAEIKEADPLAASEASQPKPCPPEVTPHYIWIDFLVQRFEIAKYCSSDQVEIFSSLLQRSMSL   1261 - 1330
NIGGAKGSMNRHVAAIGPRFKLLTLGLSLLHADVVPNATIRNVLREKIYSTAFDYFSCPPKFPTQGEKRL   1331 - 1400
REDISIMIKFWTAMFSDKKYLTASQLVPPDNQDTRSNLDITVGSRQQATQGWINTYPLSSGMSTISKKSG   1401 - 1470
MSKKTNRGSQLHKYYMKRRTLLLSLLATEIERLITWYNPLSAPELELDQAGENSVANWRSKYISLSEKQW   1471 - 1540
KDNVNLAWSISPYLAVQLPARFKNTEAIGNEVTRLVRLDPGAVSDVPEAIKFLVTWHTIDADAPELSHVL   1541 - 1610
CWAPTDPPTGLSYFSSMYPPHPLTAQYGVKVLRSFPPDAILFYIPQIVQALRYDKMGYVREYILWAASKS   1611 - 1680
QLLAHQFIWNMKTNIYLDEEGHQKDPDIGDLLDQLVEEITGSLSGPAKDFYQREFDFFNKITNVSAIIKP   1681 - 1750
YPKGDERKKACLSALSEVKVQPGCYLPSNPEAIVLDIDYKSGTPMQSAAKAPYLAKFKVKRCGVSELEKE   1751 - 1820
GLRCRSDSEDECSTQEADGQKISWQAAIFKVGDDCRQDMLALQIIDLFKNIFQLVGLDLFVFPYRVVATA   1821 - 1890
PGCGVIECIPDCTSRDQLGRQTDFGMYDYFTRQYGDESTLAFQQARYNFIRSMAAYSLLLFLLQIKDRHN   1891 - 1960
GNIMLDKKGHIIHIDFGFMFESSPGGNLGWEPDIKLTDEMVMIMGGKMEATPFKWFMEMCVRGYLAVRPY   1961 - 2030
MDAVVSLVTLMLDTGLPCFRGQTIKLLKHRFSPNMTEREAANFIMKVIQSCFLSNRSRTYDMIQYYQNDI   2031 - 2100
PY                                                                       2101 - 2102
//

Text Mined References (72)

PMID Year Title
26571211 2016 The leukodystrophy protein FAM126A (hyccin) regulates PtdIns(4)P synthesis at the plasma membrane.
25886792 2015 A novel fluorescence-based biosynthetic trafficking method provides pharmacologic evidence that PI4-kinase III? is important for protein trafficking from the endoplasmic reticulum to the plasma membrane.
25855803 2015 Germline recessive mutations in PI4KA are associated with perisylvian polymicrogyria, cerebellar hypoplasia and arthrogryposis.
25608530 2015 Plasticity of PI4KIII? interactions at the plasma membrane.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25327288 2014 Selective VPS34 inhibitor blocks autophagy and uncovers a role for NCOA4 in ferritin degradation and iron homeostasis in vivo.
25209194 2014 Synergistic association of PI4KA and GRM3 genetic polymorphisms with poor antipsychotic response in south Indian schizophrenia patients with low severity of illness.
25168678 2014 The crystal structure of the phosphatidylinositol 4-kinase II?.
24920820 2014 Mapping of functional domains of the lipid kinase phosphatidylinositol 4-kinase type III alpha involved in enzymatic activity and hepatitis C virus replication.
24671493 2014 Piperine inhibits type II phosphatidylinositol 4-kinases: a key component in phosphoinositides turnover.
24417819 2014 Mutations in tetratricopeptide repeat domain 7A result in a severe form of very early onset inflammatory bowel disease.
24415756 2014 Pharmacological and genetic targeting of the PI4KA enzyme reveals its important role in maintaining plasma membrane phosphatidylinositol 4-phosphate and phosphatidylinositol 4,5-bisphosphate levels.
24393405 2014 Overexpression of phosphatidylinositol 4-kinase type III? is associated with undifferentiated status and poor prognosis of human hepatocellular carcinoma.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24077433 2014 Genetic interactions within inositol-related pathways are associated with longitudinal changes in ventricle size.
23935497 2013 Rab18 binds to hepatitis C virus NS5A and promotes interaction between sites of viral replication and lipid droplets.
23675303 2013 The lipid kinase phosphatidylinositol-4 kinase III alpha regulates the phosphorylation status of hepatitis C virus NS5A.
23229899 2012 PtdIns4P synthesis by PI4KIII? at the plasma membrane and its impact on plasma membrane identity.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22896614 2012 Evaluation of phosphatidylinositol-4-kinase III? as a hepatitis C virus drug target.
22535966 2012 Phosphatidylinositol 4-kinase II? is palmitoylated by Golgi-localized palmitoyltransferases in cholesterol-dependent manner.
22022594 2011 The role of the phosphatidylinositol 4-kinase PI4KA in hepatitis C virus-induced host membrane rearrangement.
21697487 2011 Hepatitis C virus stimulates the phosphatidylinositol 4-kinase III alpha-dependent phosphatidylinositol 4-phosphate production that is essential for its replication.
21601653 Genetic and functional studies of phosphatidyl-inositol 4-kinase type III?.
21423176 2011 Analysis of the myosin-II-responsive focal adhesion proteome reveals a role for ?-Pix in negative regulation of focal adhesion maturation.
21330372 2011 Stabilization of phosphatidylinositol 4-kinase type IIbeta by interaction with Hsp90.
21297162 2011 Hepatitis C virus NS5A protein interacts with phosphatidylinositol 4-kinase type IIIalpha and regulates viral propagation.
21269460 2011 Initial characterization of the human central proteome.
21238945 2011 Recruitment and activation of a lipid kinase by hepatitis C virus NS5A is essential for integrity of the membranous replication compartment.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20530568 2010 The phosphatidylinositol 4-kinase PI4KIIIalpha is required for the recruitment of GBF1 to Golgi membranes.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
20052689 2010 Failure to confirm association between PIK4CA and psychosis in 22q11.2 deletion syndrome.
19946888 2010 Defining the membrane proteome of NK cells.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19608626 2009 Kinases required in hepatitis C virus entry and replication highlighted by small interference RNA screening.
19605471 2009 Class III phosphatidylinositol 4-kinase alpha and beta are novel host factor regulators of hepatitis C virus replication.
19376974 2009 Roles for endocytic trafficking and phosphatidylinositol 4-kinase III alpha in hepatitis C virus replication.
19369195 2009 Large-scale proteomics analysis of the human kinome.
19304308 2009 Identification of a lipid kinase as a host factor involved in hepatitis C virus RNA replication.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18646052 2009 Association of the PIK4CA schizophrenia-susceptibility gene in adults with the 22q11.2 deletion syndrome.
18615484 2009 Failure to confirm the association between the PIK4CA gene and schizophrenia in a Japanese population.
18585705 2008 Nuclear and nucleolar localization signals and their targeting function in phosphatidylinositol 4-kinase PI4K230.
18521859 2009 Association study between the PIK4CA gene and methamphetamine use disorder in a Japanese population.
18077555 2008 Maintenance of hormone-sensitive phosphoinositide pools in the plasma membrane requires phosphatidylinositol 4-kinase IIIalpha.
17893707 2008 An association screen of myelin-related genes implicates the chromosome 22q11 PIK4CA gene in schizophrenia.
17555516 2007 Type II phosphatidylinositol 4-kinases promote Listeria monocytogenes entry into target cells.
17131383 2006 Nucleolar localization of phosphatidylinositol 4-kinase PI4K230 in various mammalian cells.
16606619 2006 Subcellular localization and structural function of endogenous phosphorylated phosphatidylinositol 4-kinase (PI4K92).
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15634669 2005 Distinct Golgi populations of phosphatidylinositol 4-phosphate regulated by phosphatidylinositol 4-kinases.
15607035 2004 Systematic identification of hepatocellular proteins interacting with NS5A of the hepatitis C virus.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14676841 2004 Tetraspanin CD81 is linked to ERK/MAPKinase signaling by Shc in liver tumor cells.
12594831 2003 Association of T cell antigen CD7 with type II phosphatidylinositol-4 kinase, a key component in pathways of inositol phosphate turnover.
12497619 2003 Polymorphism screening of PIK4CA: possible candidate gene for chromosome 22q11-linked psychiatric disorders.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11907035 2002 Parallel activation of phosphatidylinositol 4-kinase and phospholipase C by the extracellular calcium-sensing receptor.
10591208 1999 The DNA sequence of human chromosome 22.
10101268 1999 Functional expression and characterisation of a new human phosphatidylinositol 4-kinase PI4K230.
9654085 1998 Phosphatidylinositol 4-kinases.
9360995 1997 Generation of monoclonal antibodies to integrin-associated proteins. Evidence that alpha3beta1 complexes with EMMPRIN/basigin/OX47/M6.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.
8662589 1996 Cloning, expression, and localization of 230-kDa phosphatidylinositol 4-kinase.
8246987 1993 Phosphatidylinositol (PI) 3-kinase and PI 4-kinase binding to the CD4-p56lck complex: the p56lck SH3 domain binds to PI 3-kinase but not PI 4-kinase.
7961848 1994 Cloning and characterization of a human phosphatidylinositol 4-kinase.
7761838 1995 Requirement for phosphatidylinositol transfer protein in epidermal growth factor signaling.
1318025 1992 Purification and characterization of human erythrocyte phosphatidylinositol 4-kinase. Phosphatidylinositol 4-kinase and phosphatidylinositol 3-monophosphate 4-kinase are distinct enzymes.