Property Summary

NCBI Gene PubMed Count 976
Grant Count 261
R01 Count 91
Funding $41,361,786.34
PubMed Score 969.79
PubTator Score 1264.03

Knowledge Summary

Patent (139,462)

TINX Plot

  Disease Relevance (56)

Disease Z-score Confidence
Cancer 2,346 6.337 3.2
Proteus syndrome 6 3.707 1.9
Klippel-Trenaunay syndrome 15 3.516 1.8
Adenoma 165 3.074 1.5
Adenocarcinoma 115
Adenocarcinoma Of Esophagus 14
Adenocarcinoma of lung (disorder) 48
Adenoid Cystic Carcinoma 99
BREAST-OVARIAN CANCER, FAMILIAL, SUSCEPT... 7 
Breast adenocarcinoma 8
Breast cancer 3,094 1.0
COWDEN SYNDROME 5 1
Carcinoma 2,147 2.0
Colon Carcinoma 25
Colorectal Cancer 47
Colorectal Neoplasms 217
Congenital Lipomatous Overgrowth, Vascul... 1 
Diffuse large B-cell lymphoma 41
Endometrial cancer 25 1.0
Epithelial ovarian cancer 19
Growth Disorders 33
Hamartoma Syndrome, Multiple 9
Head and neck squamous cell carcinoma 12 5.0
Hemimegalencephaly 2
Hereditary Nonpolyposis Colorectal Cance... 13 
Hyperplasia 26
IGA Glomerulonephritis 454
Kidney cancer 118 1.0
Liver carcinoma 217
Lung Neoplasms 171
Malformations of Cortical Development 11
Malignant neoplasm of breast 63
Malignant neoplasm of ovary 13
Mammary Neoplasms 410
Megalanecephaly Polymicrogyria-Polydacty... 4 
Megalencephaly cutis marmorata telangiec... 1 
Mouth Neoplasms 42
NEVUS, EPIDERMAL (disorder) 4
Penile Neoplasms 4
Prostatic Neoplasms 471
Renal Cell Carcinoma 199
Sarcoma 49
Seborrheic keratosis 6
Squamous cell carcinoma 94
Stomach Neoplasms 282
Weight Gain 87
atypical teratoid / rhabdoid tumor 4,369
ductal carcinoma in situ 1,745
invasive ductal carcinoma 2,950
juvenile dermatomyositis 1,189
lung cancer 4,466 1.0
medulloblastoma, large-cell 6,234
nasopharyngeal carcinoma 1,056
non-small cell lung carcinoma 413
ovarian neoplasm 97
psoriasis 6,685

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis -1.500 0.000
atypical teratoid / rhabdoid tumor -1.400 0.001
medulloblastoma, large-cell -1.500 0.000
juvenile dermatomyositis 1.168 0.000
ductal carcinoma in situ -1.200 0.000
invasive ductal carcinoma -1.500 0.000

Synonym

Accession P42336 Q14CW1 Q99762 PI3-kinase subunit alpha
Symbols MCM
CWS5
MCAP
PI3K
CLOVE
MCMTC
PI3K-alpha
p110-alpha

Gene

PANTHER Protein Class (2)

PDB

2RD0   3HHM   3HIZ   4JPS   4L1B   4L23   4L2Y   4OVU   4OVV   4WAF   4YKN   4ZOP   5FI4   5ITD   2ENQ   3ZIM   4TUU   4TV3   5DXH   5DXT  

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (1011)

PMID Text
27455559 The FGFR3, PIK3CA, TERT mutations, along with aberrant DNA methylation patterns, can serve as reliable genetic markers for the diagnosis of urinary bladder cancer. (Review)
27048245 Our study demonstrates that the IGF1R/p110b/AKT/mTOR axis confers resistance to BYL719 in PIK3CA mutant breast cancers
26997442 Low incidence of PIK3CA mutations in adenocarcinomas of the ampulla of Vater suggest no major role in tumorigenesis.
26995633 PIK3CA mutations detected at high frequencies in breast cancer and mostly associated with better or insignificant outcomes in estrogen receptor-positive (ER+) early stage breast cancer and tend to be with worse prognosis in ER- disease.
26945423 No relation was found between PIK3CA expression and clinical features of ovarian clear cell carcinoma. PIK3CA expression had no impact on survival.
26853422 Results suggest, a potential role for PIK3CA, VEGFR2, RET and FGFR2 as therapeutic targets in EGFR non-mutated NSCLC that requires further clinical validation.
26827608 Though Wortmannin was found to nullify the effect of H1047R over the PIK3CA, further studies are required for designing a better compound.
26823876 PIK3CA rs17849071 and rs17849079 polymorphisms may increase the risk of hepatocellular carcinoma.
26823766 Suggest that copy number loss of Variation_91720 in PIK3CA predicts risk of esophageal squamous cell carcinoma.
26820797 KRAS and PIK3CA mutations can influence the response of DLD1 colorectal cancer cell lines to MEK and PI3K inhibitors, but that the effect is dependent on the experimental model used to assess drug sensitivity.
More...

AA Sequence

MPPRPSSGELWGIHLMPPRILVECLLPNGMIVTLECLREATLITIKHELFKEARKYPLHQLLQDESSYIF      1 - 70
VSVTQEAEREEFFDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFAIGMPVCEFDMVKDPEVQDFR     71 - 140
RNILNVCKEAVDLRDLNSPHSRAMYVYPPNVESSPELPKHIYNKLDKGQIIVVIWVIVSPNNDKQKYTLK    141 - 210
INHDCVPEQVIAEAIRKKTRSMLLSSEQLKLCVLEYQGKYILKVCGCDEYFLEKYPLSQYKYIRSCIMLG    211 - 280
RMPNLMLMAKESLYSQLPMDCFTMPSYSRRISTATPYMNGETSTKSLWVINSALRIKILCATYVNVNIRD    281 - 350
IDKIYVRTGIYHGGEPLCDNVNTQRVPCSNPRWNEWLNYDIYIPDLPRAARLCLSICSVKGRKGAKEEHC    351 - 420
PLAWGNINLFDYTDTLVSGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDWFSSVVKFPDMS    421 - 490
VIEEHANWSVSREAGFSYSHAGLSNRLARDNELRENDKEQLKAISTRDPLSEITEQEKDFLWSHRHYCVT    491 - 560
IPEILPKLLLSVKWNSRDEVAQMYCLVKDWPPIKPEQAMELLDCNYPDPMVRGFAVRCLEKYLTDDKLSQ    561 - 630
YLIQLVQVLKYEQYLDNLLVRFLLKKALTNQRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLK    631 - 700
HLNRQVEAMEKLINLTDILKQEKKDETQKVQMKFLVEQMRRPDFMDALQGFLSPLNPAHQLGNLRLEECR    701 - 770
IMSSAKRPLWLNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLRMLPYGCLS    771 - 840
IGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEIYDAAIDLFTRSCAGYCVATFI    841 - 910
LGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDFLIVISKGAQECTKTREFERF    911 - 980
QEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIAYIRKTLALDKTEQEALEYFMKQMNDAHHGG    981 - 1050
WTTKMDWIFHTIKQHALN                                                       1051 - 1068
//

Text Mined References (977)

PMID Year Title
27455559 2016 [THE SOMATIC MUTATIONS AND ABERRANT METHYLATION AS POTENTIAL GENETIC MARKERS OF URINARY BLADDER CANCER].
27048245 2016 Activation of IGF1R/p110?/AKT/mTOR confers resistance to ?-specific PI3K inhibition.
26997442 2016 Low incidence of KRAS, BRAF, and PIK3CA mutations in adenocarcinomas of the ampulla of Vater and their prognostic value.
26995633 2016 New insights on PI3K/AKT pathway alterations and clinical outcomes in breast cancer.
26945423 2016 Clinicopathologic Significance of HNF-1?, AIRD1A, and PIK3CA Expression in Ovarian Clear Cell Carcinoma: A Tissue Microarray Study of 130 Cases.
26853422 Genomic profiling in a homogeneous molecular subtype of non-small cell lung cancer: An effort to explore new drug targets.
26827608 2016 Investigating the Inhibitory Effect of Wortmannin in the Hotspot Mutation at Codon 1047 of PIK3CA Kinase Domain: A Molecular Docking and Molecular Dynamics Approach.
26823876 2015 PIK3CA polymorphisms associated with susceptibility to hepatocellular carcinoma.
26823766 2015 Copy number loss of variation_91720 in PIK3CA predicts risk of esophageal squamous cell carcinoma.
26820797 2016 Pre-clinical use of isogenic cell lines and tumours in vitro and in vivo for predictive biomarker discovery; impact of KRAS and PI3KCA mutation status on MEK inhibitor activity is model dependent.
More...