Property Summary

NCBI Gene PubMed Count 7
PubMed Score 3.73
PubTator Score 2.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
cutaneous lupus erythematosus 2.000 3.2e-04
glioblastoma 1.200 1.2e-02
interstitial cystitis 1.500 2.6e-03
lung adenocarcinoma -1.200 5.8e-07
lung cancer -1.100 1.3e-02
lung carcinoma -1.600 3.2e-27
non-small cell lung cancer -1.211 2.7e-16
osteosarcoma 1.101 1.0e-05
ovarian cancer -1.200 3.2e-07
primary Sjogren syndrome 1.800 7.7e-04
subependymal giant cell astrocytoma 1.884 3.7e-03
ulcerative colitis 1.500 7.8e-04

Protein-protein Interaction (12)

Gene RIF (1)

AA Sequence

MSLKLPRNWDFNLKVEAAKIARSRSVMTGEQMAAFHPSSTPNPLERPIKMGWLKKQRSIVKNWQQRYFVL      1 - 70
RAQQLYYYKDEEDTKPQGCMYLPGCTIKEIATNPEEAGKFVFEIIPASWDQNRMGQDSYVLMASSQAEME     71 - 140
EWVKFLRRVAGTPCGVFGQRLDETVAYEQKFGPHLVPILVEKCAEFILEHGRNEEGIFRLPGQDNLVKQL    141 - 210
RDAFDAGERPSFDRDTDVHTVASLLKLYLRDLPEPVVPWSQYEGFLLCGQLTNADEAKAQQELMKQLSIL    211 - 280
PRDNYSLLSYICRFLHEIQLNCAVNKMSVDNLATVIGVNLIRSKVEDPAVIMRGTPQIQRVMTMMIRDHE    281 - 350
VLFPKSKDIPLSPPAQKNDPKKAPVARSSVGWDATEDLRISRTDSFSSMTSDSDTTSPTGQQPSDAFPED    351 - 420
SSKVPREKPGDWKMQSRKRTQTLPNRKCFLTSAFQGANSSKMEIFKNEFWSPSSEAKAGEGHRRTMSQDL    421 - 490
RQLSDSQRTSTYDNVPSLPGSPGEEASALSSQACDSKGDTLASPNSETGPGKKNSGEEEIDSLQRMVQEL    491 - 560
RKEIETQKQMYEEQIKNLEKENYDVWAKVVRLNEELEKEKKKSAALEISLRNMERSREDVEKRNKALEEE    561 - 630
VKEFVKSMKEPKTEA                                                           631 - 645
//

Text Mined References (11)

PMID Year Title