Property Summary

NCBI Gene PubMed Count 6
PubMed Score 3.73
PubTator Score 2.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung carcinoma 2844 3.21219820301047E-27
non-small cell lung cancer 2798 2.73634049479289E-16
ovarian cancer 8492 1.61963556533926E-9
lung adenocarcinoma 2714 5.80967755672011E-7
osteosarcoma 7933 1.09243695475483E-6
lung cancer 4473 1.05328108184632E-5
cutaneous lupus erythematosus 1056 3.2167404295983E-4
primary Sjogren syndrome 789 7.73620887196407E-4
ulcerative colitis 2087 7.83304029664327E-4
interstitial cystitis 2299 0.00259021037057858
subependymal giant cell astrocytoma 2287 0.00365675074053891
glioblastoma 5572 0.0122286633594379
Disease Target Count Z-score Confidence
Heart conduction disease 65 0.0 1.0

Expression

  Differential Expression (12)

Disease log2 FC p
cutaneous lupus erythematosus 2.000 0.000
osteosarcoma -3.919 0.000
glioblastoma 1.200 0.012
non-small cell lung cancer -1.211 0.000
lung cancer -3.300 0.000
interstitial cystitis 1.500 0.003
primary Sjogren syndrome 1.800 0.001
subependymal giant cell astrocytoma 1.884 0.004
lung adenocarcinoma -1.200 0.000
lung carcinoma -1.600 0.000
ulcerative colitis 1.500 0.001
ovarian cancer -1.400 0.000

Synonym

Accession P42331 A8K2Y1 B7Z498 E9PFQ7 G5E9G2 Q8IXQ2
Symbols KAIA0053
HEL-S-308

Gene

PDB

1V89  

  Ortholog (11)

Gene RIF (1)

PMID Text
19911011 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSLKLPRNWDFNLKVEAAKIARSRSVMTGEQMAAFHPSSTPNPLERPIKMGWLKKQRSIVKNWQQRYFVL      1 - 70
RAQQLYYYKDEEDTKPQGCMYLPGCTIKEIATNPEEAGKFVFEIIPASWDQNRMGQDSYVLMASSQAEME     71 - 140
EWVKFLRRVAGTPCGVFGQRLDETVAYEQKFGPHLVPILVEKCAEFILEHGRNEEGIFRLPGQDNLVKQL    141 - 210
RDAFDAGERPSFDRDTDVHTVASLLKLYLRDLPEPVVPWSQYEGFLLCGQLTNADEAKAQQELMKQLSIL    211 - 280
PRDNYSLLSYICRFLHEIQLNCAVNKMSVDNLATVIGVNLIRSKVEDPAVIMRGTPQIQRVMTMMIRDHE    281 - 350
VLFPKSKDIPLSPPAQKNDPKKAPVARSSVGWDATEDLRISRTDSFSSMTSDSDTTSPTGQQPSDAFPED    351 - 420
SSKVPREKPGDWKMQSRKRTQTLPNRKCFLTSAFQGANSSKMEIFKNEFWSPSSEAKAGEGHRRTMSQDL    421 - 490
RQLSDSQRTSTYDNVPSLPGSPGEEASALSSQACDSKGDTLASPNSETGPGKKNSGEEEIDSLQRMVQEL    491 - 560
RKEIETQKQMYEEQIKNLEKENYDVWAKVVRLNEELEKEKKKSAALEISLRNMERSREDVEKRNKALEEE    561 - 630
VKEFVKSMKEPKTEA                                                           631 - 645
//

Text Mined References (10)

PMID Year Title
24159190 2014 Genome-wide association study on dimethylarginines reveals novel AGXT2 variants associated with heart rate variability but not with overall mortality.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
19911011 2010 Mutation of ARHGAP9 in patients with coronary spastic angina.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15254788 2004 Identification and characterization of ARHGAP24 and ARHGAP25 genes in silico.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
7584044 1994 Prediction of the coding sequences of unidentified human genes. II. The coding sequences of 40 new genes (KIAA0041-KIAA0080) deduced by analysis of cDNA clones from human cell line KG-1.