Property Summary

Ligand Count 250
NCBI Gene PubMed Count 145
PubMed Score 388.06
PubTator Score 357.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count P-value
lung carcinoma 2843 5.1e-10
malignant mesothelioma 3232 6.7e-08
astrocytoma 1146 2.3e-05
Atopic dermatitis 952 7.2e-05
cystic fibrosis 1695 1.1e-04
medulloblastoma, large-cell 6241 1.1e-04
Amyotrophic lateral sclerosis 451 1.3e-04
breast carcinoma 1637 1.3e-04
acute quadriplegic myopathy 1158 1.6e-04
atypical teratoid / rhabdoid tumor 5112 1.9e-04
lung cancer 4740 2.0e-04
ductal carcinoma in situ 1744 2.1e-04
nasopharyngeal carcinoma 1058 3.7e-04
oligodendroglioma 2850 4.1e-04
pituitary cancer 1972 6.4e-04
posterior fossa group B ependymoma 416 8.4e-04
fascioscapulohumeral muscular dystrophy 100 1.0e-03
interstitial cystitis 2312 1.1e-03
intraductal papillary-mucinous adenoma (IPMA) 2954 1.4e-03
head and neck cancer and chronic obstructive pulmonary disease 239 1.4e-03
osteosarcoma 7950 1.7e-03
fibroadenoma 559 2.3e-03
Duchenne muscular dystrophy 601 3.2e-03
autosomal dominant Emery-Dreifuss muscular dystrophy 510 3.2e-03
invasive ductal carcinoma 2950 3.5e-03
colon cancer 1478 3.8e-03
dermatomyositis 966 4.5e-03
non-small cell lung cancer 2890 6.6e-03
pancreatic ductal adenocarcinoma liver metastasis 1962 7.4e-03
intraductal papillary-mucinous neoplasm (IPMN) 3290 7.4e-03
acute myeloid leukemia 783 7.6e-03
pancreatic cancer 2398 1.0e-02
medulloblastoma 720 1.1e-02
subependymal giant cell astrocytoma 2287 1.8e-02
pterygium 76 1.9e-02
limb girdle muscular dystrophy 2A 213 2.2e-02
nephrosclerosis 333 3.5e-02
glioblastoma 5792 3.8e-02
aldosterone-producing adenoma 665 3.9e-02
Common variable immunodeficiency 101 4.3e-02
head and neck cancer 270 4.9e-02
Disease Target Count Z-score Confidence
Cancer 2499 4.226 2.1

Expression

  Differential Expression (41)

Disease log2 FC p
acute myeloid leukemia -1.300 7.6e-03
acute quadriplegic myopathy 2.873 1.6e-04
aldosterone-producing adenoma -1.490 3.9e-02
Amyotrophic lateral sclerosis 1.854 1.3e-04
astrocytoma 1.200 2.3e-05
Atopic dermatitis -1.800 7.2e-05
atypical teratoid / rhabdoid tumor -2.800 1.9e-04
autosomal dominant Emery-Dreifuss muscul... 2.277 3.2e-03
breast carcinoma -2.600 1.3e-04
colon cancer -1.700 3.8e-03
Common variable immunodeficiency -1.101 4.3e-02
cystic fibrosis 1.308 1.1e-04
dermatomyositis 2.200 4.5e-03
Duchenne muscular dystrophy 1.146 3.2e-03
ductal carcinoma in situ -3.000 2.1e-04
fascioscapulohumeral muscular dystrophy 1.577 1.0e-03
fibroadenoma -2.700 2.3e-03
glioblastoma -1.600 3.8e-02
head and neck cancer -1.300 4.9e-02
head and neck cancer and chronic obstruc... -1.500 1.4e-03
interstitial cystitis -2.500 1.1e-03
intraductal papillary-mucinous adenoma (... 1.800 1.4e-03
intraductal papillary-mucinous neoplasm ... 2.000 7.4e-03
invasive ductal carcinoma -1.710 3.5e-03
limb girdle muscular dystrophy 2A 1.075 2.2e-02
lung cancer 2.200 2.0e-04
lung carcinoma -1.500 5.1e-10
malignant mesothelioma -2.900 6.7e-08
medulloblastoma -1.500 1.1e-02
medulloblastoma, large-cell -3.200 1.1e-04
nasopharyngeal carcinoma -2.800 3.7e-04
nephrosclerosis -1.077 3.5e-02
non-small cell lung cancer 1.178 6.6e-03
oligodendroglioma 1.300 4.1e-04
osteosarcoma -3.001 1.7e-03
pancreatic cancer 1.100 1.0e-02
pancreatic ductal adenocarcinoma liver m... -2.173 7.4e-03
pituitary cancer -1.800 6.4e-04
posterior fossa group B ependymoma 1.700 8.4e-04
pterygium 1.100 1.9e-02
subependymal giant cell astrocytoma 2.968 1.8e-02

Synonym

Accession P42330 A8K2V0 B4DL37 Q5T2L1 Q96DJ1 Q96KI8 Q99530 Q9UCX1 Q9UII3 Q9UKL9
Symbols DD3
DDX
PGFS
HAKRB
HAKRe
HA1753
HSD17B5
hluPGFS

Gene

PANTHER Protein Class (2)

PDB

1RY0   1RY8   1S1P   1S1R   1S2A   1S2C   1XF0   1ZQ5   2F38   2FGB   3R43   3R58   3R6I   3R7M   3R8G   3R8H   3R94   3UFY   3UG8   3UGR   3UWE   4DBS   4DBU   4DBW   4DZ5   4FA3   4FAL   4FAM   4H7C   4HMN   4WDT   4WDU   4WDW   4WDX   4WRH   4XVD   4XVE   4YVV   4YVX   4ZFC   5HNT   5HNU   5JM5  

 GWAS Trait (1)

Protein-protein Interaction (3)

Gene RIF (116)

AA Sequence

MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIA      1 - 70
DGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFD     71 - 140
IVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKD    141 - 210
IVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQN    211 - 280
VQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEY                               281 - 323
//

Text Mined References (148)

PMID Year Title