Property Summary

NCBI Gene PubMed Count 135
Grant Count 61
R01 Count 34
Funding $8,867,814.31
PubMed Score 366.51
PubTator Score 357.45

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (84)

Disease Z-score Confidence
Cancer 2,346 4.179 2.1
Amyotrophic Lateral Sclerosis 431
Ankylosing spondylitis 138
Atopic dermatitis 944
Atrophic vaginitis 14
Bursitis 10
Bursitis of shoulder 4
Common variable immunodeficiency 72
Contraception 15
Disorders of Sex Development 5
Duchenne muscular dystrophy 602
Dysfunctional uterine bleeding 9
Dysmenorrhea 19
Endometrial Hyperplasia Prevention 9
Endometrial Neoplasms 50
Endometrial carcinoma 18
Endometriosis 535
Fever 34
Gout 93
Headache disorder 20
Joint pain 8
Juvenile rheumatoid arthritis 104
Menopausal flushing 17
Menorrhagia 8
Migraine 79
Muscle pain 3
Nasal discharge 26
Neoplasms, Hormone-Dependent 3
Neoplastic Cell Transformation 81
Obesity 616
Osteoarthritis 96
Pain 70
Patent ductus arteriosus 23
Polycystic Ovary Syndrome 332
Postmenopausal osteoporosis 19
Prostatic Neoplasms 471
Prostatic Neoplasms, Castration-Resistan... 1 
Rheumatoid Arthritis 1,160
Secondary malignant neoplasm of kidney 9
Secondary physiologic amenorrhea 9
Shoulder Tendonitis 4
Sinus headache 17
Stomach Neoplasms 282
Synovitis 38
Tendinitis 13
Tenosynovitis 15
Toothache 6
acute myeloid leukemia 780
acute quadriplegic myopathy 1,157
aldosterone-producing adenoma 664
astrocytoma 1,493
atypical teratoid / rhabdoid tumor 4,369
autosomal dominant Emery-Dreifuss muscul... 499 
breast carcinoma 1,614
colon cancer 1,475
cystic fibrosis 1,665
dermatomyositis 933
ductal carcinoma in situ 1,745
fascioscapulohumeral muscular dystrophy 100
fibroadenoma 557
glioblastoma 5,572
head and neck cancer 270
head and neck cancer and chronic obstruc... 237 
interstitial cystitis 2,299
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous neoplasm ... 3,289 
invasive ductal carcinoma 2,950
limb girdle muscular dystrophy 2A 156
lung cancer 4,466
lung carcinoma 2,844
malignant mesothelioma 3,162
medulloblastoma 1,524
medulloblastoma, large-cell 6,234
nasopharyngeal carcinoma 1,056
nephrosclerosis 329
non-small cell lung cancer 2,798
oligodendroglioma 2,849
osteosarcoma 7,933
pancreatic cancer 2,300
pancreatic ductal adenocarcinoma liver m... 1,795 
pituitary cancer 1,972
posterior fossa group B ependymoma 1,530
pterygium 74
subependymal giant cell astrocytoma 2,287

Expression

  Differential Expression (41)

Disease log2 FC p
nephrosclerosis -1.077 0.035
malignant mesothelioma -2.900 0.000
astrocytoma 1.200 0.000
oligodendroglioma 1.300 0.000
osteosarcoma -3.001 0.002
cystic fibrosis 1.308 0.000
atypical teratoid / rhabdoid tumor -2.800 0.000
glioblastoma -1.600 0.038
medulloblastoma -1.500 0.011
medulloblastoma, large-cell -3.200 0.000
Duchenne muscular dystrophy 1.146 0.003
autosomal dominant Emery-Dreifuss muscul... 2.277 0.003
fascioscapulohumeral muscular dystrophy 1.577 0.001
Amyotrophic Lateral Sclerosis 1.854 0.000
acute quadriplegic myopathy 2.873 0.000
limb girdle muscular dystrophy 2A 1.075 0.022
Atopic dermatitis -1.800 0.000
pancreatic ductal adenocarcinoma liver m... -2.173 0.007
non-small cell lung cancer 1.178 0.007
Common variable immunodeficiency -1.101 0.043
intraductal papillary-mucinous adenoma (... 1.800 0.001
intraductal papillary-mucinous neoplasm ... 2.000 0.007
lung cancer 2.500 0.000
colon cancer -1.700 0.004
pancreatic cancer 1.100 0.010
breast carcinoma -2.600 0.000
fibroadenoma -2.700 0.002
interstitial cystitis -2.800 0.000
posterior fossa group B ependymoma 1.700 0.001
aldosterone-producing adenoma -1.490 0.039
subependymal giant cell astrocytoma 2.968 0.018
invasive ductal carcinoma -3.700 0.003
nasopharyngeal carcinoma -2.800 0.000
lung carcinoma -1.500 0.000
pterygium 1.100 0.019
ductal carcinoma in situ -3.000 0.000
acute myeloid leukemia -1.300 0.008
pituitary cancer -1.800 0.001
dermatomyositis 2.200 0.004
head and neck cancer -1.300 0.049
head and neck cancer and chronic obstruc... -1.500 0.001

Synonym

Accession P42330 A8K2V0 B4DL37 Q5T2L1 Q96DJ1 Q96KI8 Q99530 Q9UCX1 Q9UII3 Q9UKL9
Symbols DD3
DDX
PGFS
HAKRB
HAKRe
HA1753
HSD17B5
hluPGFS

Gene

PANTHER Protein Class (2)

PDB

1RY0   1RY8   1S1P   1S1R   1S2A   1S2C   1XF0   1ZQ5   2F38   2FGB   3R43   3R58   3R6I   3R7M   3R8G   3R8H   3R94   3UFY   3UG8   3UGR   3UWE   4DBS   4DBU   4DBW   4DZ5   4FA3   4FAL   4FAM   4H7C   4HMN   4WDT   4WDU   4WDW   4WDX   4WRH   4XVD   4XVE   4YVV   4YVX   4ZFC  

 GWAS Trait (1)

Gene RIF (106)

PMID Text
26429394 AKR1C3 expression is elevated in prostate cancer cell lines and primary prostate cancer, suggesting a link between AKR1C3 levels and the epigenetic status in prostate cancer cells.
26170067 these results indicated that the actions of AKR1C3 can produce FP receptor ligands whose activation results in carcinoma cell survival in breast cancer.
26160177 A catalysis-independent role for AKR1C3 on AR activity via Siah2 has been identified.
25849402 In the present study, crystal structures of complexes of HSD17B5 with structurally diverse inhibitors derived from high-throughput screening were determined.
25754347 and AKR1C3 may serve as a valuable therapeutic target in the treatment of castration-resistant prostate cancer
25661377 AKR1C3 mediated doxorubicin resistance might be resulted from the activation of anti-apoptosis PTEN/Akt pathway via PTEN loss.
25649766 AKR1C3 activation is a critical resistance mechanism associated with enzalutamide resistance.
25522430 AKR1C3 mRNA expression did not differ between bipolar disorder patients in any affective state or in comparison with healthy control subjects.
25514466 P450c17 and AKR1C3 inhibition may be an effective combinatorial treatment strategy.
25446850 Higher expression of PLA2G2A, PTGS2, AKR1B1, AKR1C3 and ABCC4 was seen in 22-B endometriosis cells.
More...

AA Sequence

MDSKHQCVKLNDGHFMPVLGFGTYAPPEVPRSKALEVTKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIA      1 - 70
DGSVKREDIFYTSKLWSTFHRPELVRPALENSLKKAQLDYVDLYLIHSPMSLKPGEELSPTDENGKVIFD     71 - 140
IVDLCTTWEAMEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNRSKLLDFCKSKD    141 - 210
IVLVAYSALGSQRDKRWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQN    211 - 280
VQVFEFQLTAEDMKAIDGLDRNLHYFNSDSFASHPNYPYSDEY                               281 - 323
//

Text Mined References (136)

PMID Year Title
26429394 2016 Knockdown of AKR1C3 exposes a potential epigenetic susceptibility in prostate cancer cells.
26170067 2015 11?-Prostaglandin F2?, a bioactive metabolite catalyzed by AKR1C3, stimulates prostaglandin F receptor and induces slug expression in breast cancer.
26160177 2015 The Steroidogenic Enzyme AKR1C3 Regulates Stability of the Ubiquitin Ligase Siah2 in Prostate Cancer Cells.
25849402 2015 Structures of complexes of type 5 17?-hydroxysteroid dehydrogenase with structurally diverse inhibitors: insights into the conformational changes upon inhibitor binding.
25754347 2015 ERG/AKR1C3/AR Constitutes a Feed-Forward Loop for AR Signaling in Prostate Cancer Cells.
25661377 2015 Aldo-keto reductase 1C3 (AKR1C3) is associated with the doxorubicin resistance in human breast cancer via PTEN loss.
25649766 2015 Intracrine Androgens and AKR1C3 Activation Confer Resistance to Enzalutamide in Prostate Cancer.
25522430 2014 Reduced mRNA expression of PTGDS in peripheral blood mononuclear cells of rapid-cycling bipolar disorder patients compared with healthy control subjects.
25514466 2015 The DHEA-sulfate depot following P450c17 inhibition supports the case for AKR1C3 inhibition in high risk localized and advanced castration resistant prostate cancer.
25446850 2015 Expression of AKR1B1, AKR1C3 and other genes of prostaglandin F2? biosynthesis and action in ovarian endometriosis tissue and in model cell lines.
More...