Property Summary

NCBI Gene PubMed Count 57
Grant Count 63
R01 Count 32
Funding $4,668,080.12
PubMed Score 83.68
PubTator Score 113.94

Knowledge Summary

Patent (9,167)

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma 1.500 0.004
oligodendroglioma 1.200 0.023
osteosarcoma 1.381 0.017
ependymoma -2.700 0.000
medulloblastoma -5.200 0.000
atypical teratoid / rhabdoid tumor -5.100 0.000
glioblastoma -2.100 0.008
medulloblastoma, large-cell -5.500 0.000
primitive neuroectodermal tumor -3.500 0.001
adult high grade glioma -1.100 0.008
lung carcinoma 1.400 0.000
Pick disease -1.700 0.018
gastric carcinoma -1.200 0.016
ovarian cancer -2.300 0.000

Synonym

Accession P42263 D3DTF1 Q4VXD5 Q4VXD6 Q9HDA0 Q9HDA1 Q9HDA2 Q9P0H1 GluR-3
Symbols GLUR3
GLURC
GluA3
MRX94
GLUR-C
GLUR-K3

Gene

  TechDev Info (1)

Susumu Tomita Modulation of Synaptic activity

Gene RIF (32)

PMID Text
26912664 the impaired surface expression of homomeric GluA3 receptors is caused by nonproductive assembly and aggregation to which LBD residues Tyr-454 and Arg-461 strongly contribute.
25613138 The gene expression of glutamate receptor 3 is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
25433904 This study demonstrated that the GRIA3 protein was altered in auditory cortex patient with schizophreia.
24652293 The N-terminal domain modulates alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid (AMPA) receptor desensitization.
24292102 the levels were comparable for complexes containing GluR2, GluR3 and GluR4 as well as 5-HT1A. Moreover, the levels of complexes containing muscarinic AChR M1, NR1 and GluR1 were significantly increased in male patients with AD.
23772601 An association was observed in migraine patients with the GRIA3 single nucleotide polymorphism rs3761555.
23595422 The ionotrophic glutamate receptors AMPA3 and AMPA3 were decreased in hippocampus in patient with multiple sclerosis.
23149219 the promoter methylation of the GMR2 and GMR5 genes greatly decreased the risk of schizophrenia, and the expression level of the GRM2, GRM5, and GRIA3 genes increased significantly in patients in comparison to healthy controls.
22429480 The rs557762 and the TT haplotype in the 11th haplotype block of the GRIA3 gene were associated with feelings of guilt in females.
21966062 SNP rs687577 associated with sleep duration and depression risk in Finnish women
More...

AA Sequence

MARQKKMGQSVLRAVFFLVLGLLGHSHGGFPNTISIGGLFMRNTVQEHSAFRFAVQLYNTNQNTTEKPFH      1 - 70
LNYHVDHLDSSNSFSVTNAFCSQFSRGVYAIFGFYDQMSMNTLTSFCGALHTSFVTPSFPTDADVQFVIQ     71 - 140
MRPALKGAILSLLGHYKWEKFVYLYDTERGFSILQAIMEAAVQNNWQVTARSVGNIKDVQEFRRIIEEMD    141 - 210
RRQEKRYLIDCEVERINTILEQVVILGKHSRGYHYMLANLGFTDILLERVMHGGANITGFQIVNNENPMV    211 - 280
QQFIQRWVRLDEREFPEAKNAPLKYTSALTHDAILVIAEAFRYLRRQRVDVSRRGSAGDCLANPAVPWSQ    281 - 350
GIDIERALKMVQVQGMTGNIQFDTYGRRTNYTIDVYEMKVSGSRKAGYWNEYERFVPFSDQQISNDSASS    351 - 420
ENRTIVVTTILESPYVMYKKNHEQLEGNERYEGYCVDLAYEIAKHVRIKYKLSIVGDGKYGARDPETKIW    421 - 490
NGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIV    491 - 560
FAYIGVSVVLFLVSRFSPYEWHLEDNNEEPRDPQSPPDPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSG    561 - 630
RIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYE    631 - 700
KMWSYMKSAEPSVFTKTTADGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPK    701 - 770
GSALRNAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKDKTSALSLSNVAGVFYILVGGLGLAMM    771 - 840
VALIEFCYKSRAESKRMKLTKNTQNFKPAPATNTQNYATYREGYNVYGTESVKI                    841 - 894
//

Text Mined References (57)

PMID Year Title
26912664 2016 Aggregation Limits Surface Expression of Homomeric GluA3 Receptors.
25433904 2015 Altered glutamate protein co-expression network topology linked to spine loss in the auditory cortex of schizophrenia.
24652293 2014 The N-terminal domain modulates ?-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid (AMPA) receptor desensitization.
24292102 2014 Changes of several brain receptor complexes in the cerebral cortex of patients with Alzheimer disease: probable new potential pharmaceutical targets.
23772601 2013 Association of a GRIA3 gene polymorphism with migraine in an Australian case-control cohort.
23595422 2013 Hippocampal demyelination and memory dysfunction are associated with increased levels of the neuronal microRNA miR-124 and reduced AMPA receptors.
23149219 2013 Evaluation of hypermethylation and expression pattern of GMR2, GMR5, GMR8, and GRIA3 in patients with schizophrenia.
22429480 2012 Genetic association study of individual symptoms in depression.
21966062 2011 Shared genetic background for regulation of mood and sleep: association of GRIA3 with sleep duration in healthy Finnish women.
21172611 2010 Hippocampal AMPA receptor gating controlled by both TARP and cornichon proteins.
More...