Property Summary

Ligand Count 164
NCBI Gene PubMed Count 86
PubMed Score 460.65
PubTator Score 543.57

Knowledge Summary

Patent (16,139)

Expression

  Differential Expression (8)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -4.200 9.8e-04
ependymoma -4.700 1.6e-10
glioblastoma -1.500 1.6e-02
lung carcinoma 5.700 8.8e-53
medulloblastoma, large-cell -2.900 1.2e-05
pediatric high grade glioma -2.300 5.1e-04
pituitary cancer 1.300 3.2e-04
psoriasis -1.600 1.4e-09

 CSPA Cell Line (1)

Protein-protein Interaction (1)

Gene RIF (59)

AA Sequence

MQKIMHISVLLSPVLWGLIFGVSSNSIQIGGLFPRGADQEYSAFRVGMVQFSTSEFRLTPHIDNLEVANS      1 - 70
FAVTNAFCSQFSRGVYAIFGFYDKKSVNTITSFCGTLHVSFITPSFPTDGTHPFVIQMRPDLKGALLSLI     71 - 140
EYYQWDKFAYLYDSDRGLSTLQAVLDSAAEKKWQVTAINVGNINNDKKDEMYRSLFQDLELKKERRVILD    141 - 210
CERDKVNDIVDQVITIGKHVKGYHYIIANLGFTDGDLLKIQFGGANVSGFQIVDYDDSLVSKFIERWSTL    211 - 280
EEKEYPGAHTTTIKYTSALTYDAVQVMTEAFRNLRKQRIEISRRGNAGDCLANPAVPWGQGVEIERALKQ    281 - 350
VQVEGLSGNIKFDQNGKRINYTINIMELKTNGPRKIGYWSEVDKMVVTLTELPSGNDTSGLENKTVVVTT    351 - 420
ILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKIWNGMVGELVY    421 - 490
GKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVV    491 - 560
LFLVSRFSPYEWHTEEFEDGRETQSSESTNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFT    561 - 630
LIIISSYTANLAAFLTVERMVSPIESAEDLSKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEP    631 - 700
SVFVRTTAEGVARVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLRNAVNLA    701 - 770
VLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKEKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSR    771 - 840
AEAKRMKVAKNAQNINPSSSQNSQNFATYKEGYNVYGIESVKI                               841 - 883
//

Text Mined References (91)

PMID Year Title