Property Summary

NCBI Gene PubMed Count 81
Grant Count 591
R01 Count 325
Funding $82,706,470.64
PubMed Score 422.27
PubTator Score 543.57

Knowledge Summary

Patent (16,139)

Expression

  Differential Expression (8)

Disease log2 FC p
glioblastoma -3.800 0.000
posterior fossa group A ependymoma -5.000 0.000
atypical teratoid / rhabdoid tumor -4.600 0.000
medulloblastoma, large-cell -3.600 0.000
pediatric high grade glioma -2.500 0.004
psoriasis -1.600 0.000
lung carcinoma 5.700 0.000
pituitary cancer 1.300 0.000

Synonym

Accession P42262 A8MT92 I6L997 Q96FP6 GluR-2
Symbols GLUR2
GLURB
GluA2
HBGR2
GluR-K2

Gene

PDB

2WJW   2WJX   2XHD   3R7X   3RN8   3RNN   3UA8   5H8S  

  TechDev Info (1)

Susumu Tomita Modulation of Synaptic activity

Gene RIF (56)

PMID Text
26744192 A transient positive feedback mechanism between AMPAR and stargazin has implications for information processing in the brain, because it should allow activity-dependent facilitation of excitatory synaptic transmission through a postsynaptic mechanism.
26311781 The GluR2 subunit of the AMPA receptor is involved in cell migration and calcium signaling.
25842862 GRIA2*CCC polymorphism is genetic risk marker for paranoid schizophrenia in Russians.Low risk genetic markers of paranoid schizophrenia were revealed: in Tatars-GRIA2*T/T (rs43025506) of GRIA2 gene and GRIA2*CCT in Russians.
25784538 RAB39B selectively regulates GluA2 trafficking to determine synaptic AMPAR composition
24679603 a link between neurodegenerative processes and deficient RNA editing of the GluA2 Q/R site.
24652293 The N-terminal domain modulates alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid (AMPA) receptor desensitization.
24623784 We show that excitatory cortical-patterned neurons derived from multiple human pluripotent stem cell lines exhibit native-like maturation changes in AMPAR composition such that there is an increase in the expression of GluA2(R) subunits.
24550387 analysis of changes in receptor kinetics with the R628E charge-inverting mutation in the "linker" region of alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid (AMPA) receptor
24512576 Statistical analysis showed no association between migraine and the GRIA2 and GRIA4 polymorphisms investigated.
24456377 GRIA2 is a useful marker for distinguishing solitary fibrous tumour from most mimics
More...

AA Sequence

MQKIMHISVLLSPVLWGLIFGVSSNSIQIGGLFPRGADQEYSAFRVGMVQFSTSEFRLTPHIDNLEVANS      1 - 70
FAVTNAFCSQFSRGVYAIFGFYDKKSVNTITSFCGTLHVSFITPSFPTDGTHPFVIQMRPDLKGALLSLI     71 - 140
EYYQWDKFAYLYDSDRGLSTLQAVLDSAAEKKWQVTAINVGNINNDKKDEMYRSLFQDLELKKERRVILD    141 - 210
CERDKVNDIVDQVITIGKHVKGYHYIIANLGFTDGDLLKIQFGGANVSGFQIVDYDDSLVSKFIERWSTL    211 - 280
EEKEYPGAHTTTIKYTSALTYDAVQVMTEAFRNLRKQRIEISRRGNAGDCLANPAVPWGQGVEIERALKQ    281 - 350
VQVEGLSGNIKFDQNGKRINYTINIMELKTNGPRKIGYWSEVDKMVVTLTELPSGNDTSGLENKTVVVTT    351 - 420
ILESPYVMMKKNHEMLEGNERYEGYCVDLAAEIAKHCGFKYKLTIVGDGKYGARDADTKIWNGMVGELVY    421 - 490
GKADIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVV    491 - 560
LFLVSRFSPYEWHTEEFEDGRETQSSESTNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFT    561 - 630
LIIISSYTANLAAFLTVERMVSPIESAEDLSKQTEIAYGTLDSGSTKEFFRRSKIAVFDKMWTYMRSAEP    631 - 700
SVFVRTTAEGVARVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSSLRNAVNLA    701 - 770
VLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKEKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSR    771 - 840
AEAKRMKVAKNAQNINPSSSQNSQNFATYKEGYNVYGIESVKI                               841 - 883
//

Text Mined References (86)

PMID Year Title
26744192 2016 Superactivation of AMPA receptors by auxiliary proteins.
26311781 2015 Myelin Proteolipid Protein Complexes with ?v Integrin and AMPA Receptors In Vivo and Regulates AMPA-Dependent Oligodendrocyte Progenitor Cell Migration through the Modulation of Cell-Surface GluR2 Expression.
25842862 [Glutamate receptors genes polymorphism and the risk of paranoid schizophrenia in Russians and tatars from the Republic of Bashkortostan].
25784538 2015 The intellectual disability protein RAB39B selectively regulates GluA2 trafficking to determine synaptic AMPAR composition.
24679603 2014 Hippocampus-specific deficiency in RNA editing of GluA2 in Alzheimer's disease.
24652293 2014 The N-terminal domain modulates ?-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid (AMPA) receptor desensitization.
24623784 2014 Maturation of AMPAR composition and the GABAAR reversal potential in hPSC-derived cortical neurons.
24550387 2014 A charge-inverting mutation in the "linker" region of ?-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid (AMPA) receptors alters agonist binding and gating kinetics independently of allosteric modulators.
24512576 2014 Genetic analysis of GRIA2 and GRIA4 genes in migraine.
24456377 2014 GRIA2 is a novel diagnostic marker for solitary fibrous tumour identified through gene expression profiling.
More...