Property Summary

NCBI Gene PubMed Count 104
Grant Count 517
R01 Count 290
Funding $45,471,680.73
PubMed Score 1376.55
PubTator Score 446.75

Knowledge Summary

Patent (10,090)

Expression

  Differential Expression (13)

Disease log2 FC p
oligodendroglioma 1.700 0.001
glioblastoma -2.300 0.000
posterior fossa group A ependymoma -1.800 0.000
sonic hedgehog group medulloblastoma -3.300 0.000
atypical teratoid / rhabdoid tumor -3.000 0.001
medulloblastoma, large-cell -2.700 0.000
primitive neuroectodermal tumor -1.200 0.030
non-small cell lung carcinoma -2.200 0.000
lung cancer -3.200 0.000
lung adenocarcinoma -2.200 0.000
adult high grade glioma -1.900 0.006
lung carcinoma -2.300 0.000
Pick disease -1.100 0.011

Synonym

Accession P42261 B7Z2S0 B7Z2W8 B7Z3F6 B7Z9G9 D3DQI4 E7ESV8 Q2NKM6 GluR-1
Symbols GLUH1
GLUR1
GLURA
GluA1
HBGR1

Gene

  TechDev Info (1)

Susumu Tomita Modulation of Synaptic activity

Gene RIF (60)

PMID Text
26862833 The findings do not support the association of GRIA1 SNPs with schizophrenia in the Chinese Han population.
26800698 Our data of this study confirmed the association of GRIA1 (rs2195450) to female migraine susceptibility in the Chinese Han population.
25697915 Polymorphisms in GRIA1 gene are a risk factor for asparaginase hypersensitivity during the treatment of childhood acute lymphoblastic leukemia
25613138 The gene expression of glutamate receptor 1 is significantly upregulated in clade B Tat treated SK-N-MC neuroblastoma cells
25533481 The level of phosphorylated GluA1 at S831 and S845, two major sites implicated in AMPAR regulation, is almost negligible. Results impel us to reconsider the mechanisms underlying synaptic plasticity.
25232120 The gene expression of glutamate receptor 1 is significantly upregulated in clade B Tat treated SK-N-MC neuroblastoma cells
24652293 The N-terminal domain modulates alpha-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid (AMPA) receptor desensitization.
24452473 insight into the structure and function of the C-terminal domain of GluA1, which controls AMPA receptor function and trafficking during synaptic plasticity in the central nervous system.
24292102 the levels were comparable for complexes containing GluR2, GluR3 and GluR4 as well as 5-HT1A. Moreover, the levels of complexes containing muscarinic AChR M1, NR1 and GluR1 were significantly increased in male patients with AD.
24030684 This study failed to replicate previously reported association between GRIA1 rs548294 and migraine without aura, either as single marker or when analyzed in haplotype combination with rs2195450.
More...

AA Sequence

MQHIFAFFCTGFLGAVVGANFPNNIQIGGLFPNQQSQEHAAFRFALSQLTEPPKLLPQIDIVNISDSFEM      1 - 70
TYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPSFPVDTSNQFVLQLRPELQDALISIIDHY     71 - 140
KWQKFVYIYDADRGLSVLQKVLDTAAEKNWQVTAVNILTTTEEGYRMLFQDLEKKKERLVVVDCESERLN    141 - 210
AILGQIIKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTIPAKIMQQWKNSDARDHTR    211 - 280
VDWKRPKYTSALTYDGVKVMAEAFQSLRRQRIDISRRGNAGDCLANPAVPWGQGIDIQRALQQVRFEGLT    281 - 350
GNVQFNEKGRRTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYV    351 - 420
MLKKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGELVYGRADVAV    421 - 490
APLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRF    491 - 560
SPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSY    561 - 630
TANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTT    631 - 700
EEGMIRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRNPVNLAVLKLNEQ    701 - 770
GLLDKLKNKWWYDKGECGSGGGDSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMK    771 - 840
GFCLIPQQSINEAIRTSTLPRNSGAGASSGGSGENGRVVSHDFPKSMQSIPCMSHSSGMPLGATGL        841 - 906
//

Text Mined References (107)

PMID Year Title
26862833 2016 No association of GRIA1 polymorphisms with schizophrenia in the Chinese Han population.
26800698 2015 Case-control study of GRIA1 and GRIA3 gene variants in migraine.
25697915 2015 Polymorphisms in GRIA1 gene are a risk factor for asparaginase hypersensitivity during the treatment of childhood acute lymphoblastic leukemia.
25533481 2015 Stoichiometry and phosphoisotypes of hippocampal AMPA-type glutamate receptor phosphorylation.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24652293 2014 The N-terminal domain modulates ?-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid (AMPA) receptor desensitization.
24452473 2014 Regulation of GluA1 ?-amino-3-hydroxy-5-methyl-4-isoxazolepropionic acid receptor function by protein kinase C at serine-818 and threonine-840.
24292102 2014 Changes of several brain receptor complexes in the cerebral cortex of patients with Alzheimer disease: probable new potential pharmaceutical targets.
24030684 2014 Lack of association between GRIA1 polymorphisms and haplotypes with migraine without aura or response to triptans.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
More...