Property Summary

Ligand Count 4
NCBI Gene PubMed Count 308
PubMed Score 960.22
PubTator Score 988.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
ductal carcinoma in situ -1.400 2.6e-04
group 4 medulloblastoma 1.200 8.8e-05
invasive ductal carcinoma -1.800 2.5e-04
lung cancer -1.700 6.1e-04
malignant mesothelioma -1.200 2.0e-06
osteosarcoma -1.681 3.6e-05

 GO Component (2)

Protein-protein Interaction (7)

Gene RIF (246)

AA Sequence

MAGWIQAQQLQGDALRQMQVLYGQHFPIEVRHYLAQWIESQPWDAIDLDNPQDRAQATQLLEGLVQELQK      1 - 70
KAEHQVGEDGFLLKIKLGHYATQLQKTYDRCPLELVRCIRHILYNEQRLVREANNCSSPAGILVDAMSQK     71 - 140
HLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESLRIQAQFAQLAQLSPQERLSRETALQQKQVS    141 - 210
LEAWLQREAQTLQQYRVELAEKHQKTLQLLRKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCE    211 - 280
KLAEIIWQNRQQIRRAEHLCQQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAA    281 - 350
TVRLLVGGKLNVHMNPPQVKATIISEQQAKSLLKNENTRNECSGEILNNCCVMEYHQATGTLSAHFRNMS    351 - 420
LKRIKRADRRGAESVTEEKFTVLFESQFSVGSNELVFQVKTLSLPVVVIVHGSQDHNATATVLWDNAFAE    421 - 490
PGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNNSSSHLEDYSGLSVSWSQFNR    491 - 560
ENLPGWNYTFWQWFDGVMEVLKKHHKPHWNDGAILGFVNKQQAHDLLINKPDGTFLLRFSDSEIGGITIA    561 - 630
WKFDSPERNLWNLKPFTTRDFSIRSLADRLGDLSYLIYVFPDRPKDEVFSKYYTPVLAKAVDGYVKPQIK    631 - 700
QVVPEFVNASADAGGSSATYMDQAPSPAVCPQAPYNMYPQNPDHVLDQDGEFDLDETMDVARHVEELLRR    701 - 770
PMDSLDSRLSPPAGLFTSARGSLS                                                  771 - 794
//

Text Mined References (320)

PMID Year Title