Property Summary

NCBI Gene PubMed Count 280
Grant Count 142
R01 Count 90
Funding $8,624,134.54
PubMed Score 912.96
PubTator Score 988.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma -1.200 0.000
osteosarcoma -1.681 0.000
lung cancer -2.600 0.000
group 4 medulloblastoma 1.200 0.000
ductal carcinoma in situ -1.400 0.000
invasive ductal carcinoma -1.800 0.000

Synonym

Accession P42229 Q1KLZ6
Symbols MGF
STAT5

Gene

PANTHER Protein Class (1)

Gene RIF (219)

PMID Text
27077371 Foxp3 has a rapid turn over in Treg partly controlled at the transcriptional level by the JAK/STAT pathway
27016479 PTP1B directly regulates STAT5 phosphorylation and its activation via the cAMP/PKA pathway downstream of the 5-HT7 receptor is involved in the suppression of beta-casein expression in MCF-12A cells
26970274 prolactin activation of Stat5 results in the formation of a complex between phospho-Stat5 and BRCA1. Formation of this complex does not interfere with nuclear translocation or binding of BRCA1 to the p21 promoter
26717567 The two STAT5 isoforms, STAT5a and STAT5b.
26707639 Our study suggests that pyrvinium is a useful addition to T-cell lymphoma treatment, and emphasizes the potential therapeutic value of the differences in the mitochondrial characteristics between malignant and normal T-cells in blood cancer.
26695634 The innate immune regulator STAT-5 is shown to regulate transcription of the ATR binding factor TopBP1, and this is critical for the induction of the ATR pathway in human papillomavirus-infected keratinocytes.
26551078 that STAT-5, RUNX-2, and FGFR-2 may have a role in the progression of the mucinous phenotype, in which nuclear STAT-5 may inhibit RUNX-2 prometastatic effect
26387651 D5 Stat5a plays pathogenic role in breast cancer through, at least partly, increasing trimethylation of the IGFBP-7 promoter region, thereby inhibiting IGFBP-7 expression.
26362718 support the concept that Jak2-Stat5a/b signaling promotes metastatic progression of prostate cancer by inducing epithelial-to-mesenchymal transition and stem cell properties in prostate cancer cells
26260387 CD82 regulated BCL2L12 expression via STAT5A and AKT signaling and stimulated proliferation and engrafting of leukemia cells.
More...

AA Sequence

MAGWIQAQQLQGDALRQMQVLYGQHFPIEVRHYLAQWIESQPWDAIDLDNPQDRAQATQLLEGLVQELQK      1 - 70
KAEHQVGEDGFLLKIKLGHYATQLQKTYDRCPLELVRCIRHILYNEQRLVREANNCSSPAGILVDAMSQK     71 - 140
HLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESLRIQAQFAQLAQLSPQERLSRETALQQKQVS    141 - 210
LEAWLQREAQTLQQYRVELAEKHQKTLQLLRKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCE    211 - 280
KLAEIIWQNRQQIRRAEHLCQQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAA    281 - 350
TVRLLVGGKLNVHMNPPQVKATIISEQQAKSLLKNENTRNECSGEILNNCCVMEYHQATGTLSAHFRNMS    351 - 420
LKRIKRADRRGAESVTEEKFTVLFESQFSVGSNELVFQVKTLSLPVVVIVHGSQDHNATATVLWDNAFAE    421 - 490
PGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNNSSSHLEDYSGLSVSWSQFNR    491 - 560
ENLPGWNYTFWQWFDGVMEVLKKHHKPHWNDGAILGFVNKQQAHDLLINKPDGTFLLRFSDSEIGGITIA    561 - 630
WKFDSPERNLWNLKPFTTRDFSIRSLADRLGDLSYLIYVFPDRPKDEVFSKYYTPVLAKAVDGYVKPQIK    631 - 700
QVVPEFVNASADAGGSSATYMDQAPSPAVCPQAPYNMYPQNPDHVLDQDGEFDLDETMDVARHVEELLRR    701 - 770
PMDSLDSRLSPPAGLFTSARGSLS                                                  771 - 794
//

Text Mined References (291)

PMID Year Title
27077371 2016 Inhibition of the JAK/STAT Signaling Pathway in Regulatory T Cells Reveals a Very Dynamic Regulation of Foxp3 Expression.
27016479 2016 Serotonin suppresses ?-casein expression via PTP1B activation in human mammary epithelial cells.
26970274 2016 Prolactin inhibits a major tumor-suppressive function of wild type BRCA1.
26717567 2015 How Intrinsic Molecular Dynamics Control Intramolecular Communication in Signal Transducers and Activators of Transcription Factor STAT5.
26707639 2016 Pyrvinium selectively induces apoptosis of lymphoma cells through impairing mitochondrial functions and JAK2/STAT5.
26695634 2015 STAT-5 Regulates Transcription of the Topoisomerase II?-Binding Protein 1 (TopBP1) Gene To Activate the ATR Pathway and Promote Human Papillomavirus Replication.
26551078 2016 Nuclear staining of fgfr-2/stat-5 and runx-2 in mucinous breast cancer.
26387651 2015 Histone 3 Trimethylation of IGFBP-7 Gene Promoter by Expression of D5 Stat5a in Breast Epithelial Cells.
26362718 2015 Jak2-Stat5a/b Signaling Induces Epithelial-to-Mesenchymal Transition and Stem-Like Cell Properties in Prostate Cancer.
26260387 2015 The novel function of CD82 and its impact on BCL2L12 via AKT/STAT5 signal pathway in acute myelogenous leukemia cells.
More...