Property Summary

NCBI Gene PubMed Count 280
PubMed Score 912.96
PubTator Score 988.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma -1.200 2.0e-06
osteosarcoma -1.681 3.6e-05
lung cancer -2.600 1.5e-05
group 4 medulloblastoma 1.200 8.8e-05
ductal carcinoma in situ -1.400 2.6e-04
invasive ductal carcinoma -1.800 2.5e-04

Gene RIF (218)

PMID Text
27077371 Foxp3 has a rapid turn over in Treg partly controlled at the transcriptional level by the JAK/STAT pathway
27016479 PTP1B directly regulates STAT5 phosphorylation and its activation via the cAMP/PKA pathway downstream of the 5-HT7 receptor is involved in the suppression of beta-casein expression in MCF-12A cells
26970274 prolactin activation of Stat5 results in the formation of a complex between phospho-Stat5 and BRCA1. Formation of this complex does not interfere with nuclear translocation or binding of BRCA1 to the p21 promoter
26717567 The two STAT5 isoforms, STAT5a and STAT5b.
26707639 Our study suggests that pyrvinium is a useful addition to T-cell lymphoma treatment, and emphasizes the potential therapeutic value of the differences in the mitochondrial characteristics between malignant and normal T-cells in blood cancer.
26695634 The innate immune regulator STAT-5 is shown to regulate transcription of the ATR binding factor TopBP1, and this is critical for the induction of the ATR pathway in human papillomavirus-infected keratinocytes.
26551078 that STAT-5, RUNX-2, and FGFR-2 may have a role in the progression of the mucinous phenotype, in which nuclear STAT-5 may inhibit RUNX-2 prometastatic effect
26387651 D5 Stat5a plays pathogenic role in breast cancer through, at least partly, increasing trimethylation of the IGFBP-7 promoter region, thereby inhibiting IGFBP-7 expression.
26362718 support the concept that Jak2-Stat5a/b signaling promotes metastatic progression of prostate cancer by inducing epithelial-to-mesenchymal transition and stem cell properties in prostate cancer cells
26260387 CD82 regulated BCL2L12 expression via STAT5A and AKT signaling and stimulated proliferation and engrafting of leukemia cells.
26252941 High phosphorylated signal transducer and activator of transcription 5 is associated with mammary analogue secretory carcinoma of the salivary gland.
26238487 Data indicate direct effects of sorafenib on the Janus kinase JAK1-transcription factors STAT3/5 signaling pathway in immune cells.
26146825 Data show that both signal transducer and activation of transcription factors STAT5 and STAT3 were activated in significant percentages of cells in atypical ductal hyperplasia (ADH).
26059451 STAT5A positively regulates levels of DNMT3A, resulting in inactivation of tumor suppressor genes by epigenetic mechanisms in acute myeloid leukemia cells.
25953263 Upregulation of STAT5A is associated with chronic myeloid leukemia.
25896132 STAT3 and STAT5A were bound to the xCT promoter.
25885255 constitutively active STAT5A(S710F) escapes from SFK-mediated cytoplasmic retention by enhancing STAT5A dimer stability
25773877 Decreased expression of STAT5 was associated with metastases in Colon Carcinoma.
25769613 ICOS-ICOS-L interaction promoted cytokine production and survival in type 2 innate lymphoid cells through STAT5 signaling in asthma.
25736842 STAT-5 is activated constitutively in peripheral blood leucocytes in patients with primary Sjogren's syndrome, and basal STAT-5 phosphorylation seems to associate with hypergammaglobulinaemia, anti-SSB antibody production and purpura.
25673709 STAT-5 regulates Tip60 activation and this occurs in part by targeting glycogen synthase kinase 3beta during papillomavirus infection.
25552366 Both Stat5a/b genetic knockdown and antiandrogen treatment induced proteasomal degradation of AR in prostate cancer cells.
25509109 JAK3/STAT5 signaling via IL-2 receptor is necessary to maintain the long-term expression of the high-affinity alpha beta gamma(c)-receptor of IL-2 and optimal proliferation of blood lymphocytes.
25470773 These data provide the first definitive evidence for a contribution of STAT5a/b to the sex bias in pulmonary hypertension in the hypoxic mouse and implicate reduced STAT5 in the pathogenesis of the human disease.
25456130 These results reveal a leukemic pathway involving FAK/Tiam1/Rac1/PAK1 and demonstrate an essential role for these signaling molecules in regulating the nuclear translocation of Stat5 in leukemogenesis.
25373509 the ETV6/ARG oncoprotein contributes to autonomous cell growth by compensating for the requirement of growth factor through activating STAT5 signaling, which leads to the up-regulation of c-Myc.
25352693 The role of STAT proteins, including STAT5, and NF-kappa B in the death of Caco 2 cells incubated with Entamoeba histolytica is reported.
25231404 Calreticulin promotes migration and invasion of esophageal cancer cells by upregulating neuropilin-1 expression via STAT5A.
25205818 Data suggest that STAT5A and STAT5B (highly conserved genes; 96% identity in amino acid sequences) are nearly identical in responses to growth hormone; STAT1 and STAT3 exhibit weaker binding to DNA elements in insulin-like growth factor-I gene.
25092144 A novel network has been described in acute myeloid leukemia in which FLT3-ITD signaling induces oncogenic miR-155 by p65 and STAT5 thereby targeting transcription factor PU.1.
25043756 In tumor cells without functioning androgen receptor, cell proliferation is activated via the STAT5 pathway, which in turn promotes castration-resistant prostate cancer cell survival.
24925029 Inhibition of STAT5a by Naa10 contributes to decreased breast cancer metastasis.
24913037 LKB1 is differentially regulated by PRL at the level of transcription in representative human breast cancer cells. Its promoter is targeted by STAT3 and STAT5A, and the cellular estrogen receptor status may affect PRL-responsiveness
24878107 no statistically significant association between polymorphism and glioblastoma risk was observed in STAT5a
24821571 NAMPT promoter activity was increased by pharmacologic promoter demethylation and inhibited by STAT5 silencing.
24813920 STAT5 appears to be a critical determinant of the time-dependent sensitivity of CML progenitor cells to TKI treatment in a Bcr-Abl-dependent, but JAK-independent, manner
24753251 These data reveal a previously unrecognized BCR-ABL-STAT5-IRF-8 network, which widens the repertoire of potentially new anti-chronic myeloid leukemia targets.
24681953 Persistent STAT5 activation in myeloid neoplasms recruits p53 into gene regulation.
24608043 Role of C9orf140 in the promotion of colorectal cancer progression and mechanisms of its upregulation via activation of STAT5, beta-catenin and EZH2.
24587342 FRA2 is a STAT5 target gene regulated by IL-2 in human CD4 T cells.
24523507 Data indicate that STAT5A and STAT5B transcription activator complex induces expression of CD80 gene.
24497979 Identification of genes regulated by STAT5A and/or STAT5B in CD4 positive T-lymphocytes.
24384092 We have identified a new variant of human Stat5a, found at higher ratios to full-length Stat5a in invasive ductal carcinoma versus contiguous normal tissue
24376517 TMPRSS6 inhibition via decreased STAT5 phosphorylation may be an additional mechanism by which inflammation stimulates hepcidin expression to regulate iron homeostasis and immunity.
24335105 STAT5 is involved in regulating IgM production in Waldenstrom's macroblobulinemia(WM) and inhibition of STAT5 may represent a novel therapeutic strategy for lowering IgM levels in WM patients.
24263804 PAK-dependent serine phosphorylation of STAT5 is unaffected by BCR-ABL tyrosine kinase inhibitor treatment
24204704 Data indicate that in type 1 diabetes monocytes STAT5Ptyr activation is significantly higher and is found bound to CSF2 promoter and PTGS2 enhancer regions.
24155890 These findings provide insights in the STAT5 dependent transcriptional regulation of Dpf3.
24135280 EGF, EGFRvIII, STAT3 and STAT5 have roles in progression of glioblastoma
24068731 Selective impairment of STAT5 phosphorylation with CAS 285986-31-4 markedly reduced induced T regulatory cells.
24040307 Pim-1 kinase has a role in phosphorylating and stabilizing 130 kDa FLT3 and promoting aberrant STAT5 signaling in acute myeloid leukemia with FLT3 internal tandem duplication
24004716 Prolactin-Stat5 signaling in breast cancer is potently disrupted by acidosis within the tumor microenvironment.
23773921 These results indicate that STAT5B and STAT5A act partly as non-redundant transcription factors and that STAT5B is more critical for Treg maintenance and function in humans.
23733954 These results suggest that unphosphorylated STAT5A may epigenetically suppress tumor growth by promoting heterochromatin formation.
23729680 These observations demonstrate a STAT5/PRL/VEGF signaling cascade in human brain endothelial cells.
23716595 STAT5 represses BCL6 expression below basal levels and decreases the association of RNA polymerase II at the gene.
23660011 The work presented herein provides the first evidence of somatic STAT5A/B gene amplification in clinical prostate cancer.
23621408 IL-31 induces pro-inflammatory effects in activated human macrophages via STAT-1 and 5 phosphorylation. Interleukin-31-induced ERK 1/2 activation contributes to the underlying mechanism of Th1 cytokine IL-12 suppression in macrophages.
23593005 these findings identify an important new regulatory mechanism by which the innate immune regulator, STAT-5, promotes HPV viral replication through activation of the ATM DNA damage response.
23465551 Remote ischemic preconditioning during propofol anesthesia did not evoke either signal transducer and activator of transcription 5 activation or cardioprotection.
23458731 Suggest the existence of a feed-forward loop accelerating chronic myeloid leukemia progression, in which BCR-ABL1 enhances its own mutation rate in a STAT5-reactive oxygen species dependent manner.
23438599 Fyn regulates the activity of the adipogenic transcription factor signal transducer and activator of transcription 5a (STAT5a) through enhancing its interaction with the GTPase phosphoinositide 3-kinase enhancer A (PIKE-A).
23406773 Studies indicate that JAK/STAT pathway as a common underlying biologic abnormality in myeloproliferative neoplasms (MPN), and Ruxolitinib, a JAK1 and JAK2 inhibitor has recently been approved for the treatment.
23332799 Oleic acid induces cell migration through a Stat5-dependent pathway and Stat5 activation requires arachidonic acid metabolites in MDA-MB-231 breast cancer cells.
23262295 STAT5 was implicated in the leptin-mediated expression of microRNA-182 and microRNA-96 in ovarian cancer cells, which might provide preliminary experimental clues for the development of new therapies against ovarian cancer.
23243289 examined Stat3 and Stat5 activation patterns in resting and ligand-stimulated primary samples from pediatric patients with acute myeloid leukemia
23223023 These data provide first insights on how mechanistically palmitic acid drives endothelial progenitor cell and bone marrow-derived hematopoietic cell dysfunction in diabetes.
23161573 deregulated Stat5 activity represents a genuine risk factor for breast cancer.
23151802 STAT5A/B regulate endoplasmic reticulum structure in the cytoplasm through nonnuclear mechanisms.
23134344 These results suggest a critical association between altered expression of STAT-3 and STAT-5 with SOCS-1 and indicate its potential role as a negative regulator independent of JAK-STAT pathway in tumorigenic transformation of prostate tissue.
23111066 Data indicate that knockdown of HDAC8 resulted in the increased expression of SOCS1 and SOCS3, and overexpression of SOCS1 and SOCS3 significantly inhibited cell growth and suppressed JAK2/STAT signaling.
23036105 Loss of Stat5a represents a new independent marker of poor prognosis in node-negative breast cancer and may be a predictor of response to antiestrogen therapy if validated in randomized clinical trials.
22926520 SFK mediate cytoplasmic retention of pSTAT5A in BCR-ABL-positive cells
22781567 There is a lower expression of phosphorylated STAT5 in G-CSF or SCF stimulated paroxysmal nocturnal hemoglobinuria clone cells compared to that in normal clone cells.
22753752 The expression levels of STAT5A gene were significantly reduced in enalapril-treated HL60 cells as compared to untreated controls.
22367509 inhibition of STAT5a significantly promoted CRC cell apoptosis by CDDP and 5-Fu.
22196377 STAT5 polymorphisms contribute to rheumatoid arthritis susceptibility, activity, and severity in an Egyptian population.
22159083 the present study provides novel evidence for nongenomic functions of STAT5 species in the cytoplasm aimed at preserving the structure and function of the Golgi apparatus-ER unit.
22065720 STAT5CA expression can render TCs resistant to the immunosuppressive environment of melanoma tumors
22046434 calpastatin overexpression suppressed IL-17 production by Th cells by up-regulating the STAT5 signal
21826656 STAT5A/B regulate colorectal cancer cell apoptosis via reduction of mitochondrial membrane potential and generation of reactive oxygen species.
21816901 The association of the PRLr with HMGN2 enables Stat5a-responsive promoter binding, thus facilitating transcriptional activation and promoting anchorage-independent growth.
21785216 Prolactin increases SMN expression and survival in a mouse model of severe spinal muscular atrophy via the STAT5 pathway
21749449 JAK2V617F allele burden was higher in polycythemia vera (PV) and primary myelofibrosis (PMF) patients compared with low allele burden in essential thrombocythemia (ET) and early PMF; higher phosphorylation of STAT5 and STAT3 in JAK2V617F positive group
21704724 the molecular structure and biological functions of Stat5a/b are reviewed. [Review]
21698228 Parvovirus B19 infection of primary human erythroid progenitor cells at hypoxia is regulated by STAT5A and MEK signaling but not HIFalpha.
21619451 Flow cytometry was used for detection of pSTAT5 and CD95 expression in CD4+ T lymphocytes treated with recombinant human EPO.
21606506 Ebf1 or Pax5 haploinsufficiency synergizes with STAT5 activation to initiate acute lymphoblastic leukemia
21602494 By regulating STAT5 activity, cytokines present at specific locations and under different pathophysiological conditions can determine the fate of DC precursors.
21542777 STAT5A is necessary for human bone marrow-derived stromal cell adipogenesis.
21531896 Data show that HPV-specific T cells from RRP patients exhibited reduced STAT-5 phosphorylation and reduced IFN-gamma and IL-2 secretion.
21464042 FGFR-2, STAT5, and progesterone receptors have roles in breast cancer
21263150 HIF2alpha is an important STAT5 target gene in human hematopoietic stem cells.
21233313 targeting STAT5 may be an effective strategy for the treatment of chronic myelogenous leukemia and other myeloproliferative diseases.
21220747 STAT5 may serve as an attractive target to overcome imatinib resistance in BCR-ABL1(+) leukemia.
21079973 Phosphorylated Stat5 may play an important role in cyclin D1 overexpression and contribute to colonic adenocarcinoma progression.
20974963 role of JAK1 and JAK2 in TSLP-mediated STAT5 phosphorylation in mouse and human primary CD4(+) T cells, in contrast to the known activation of JAK1 and JAK3 by the related cytokine, IL-7
20952588 PTP1B as an important negative regulator of Stat5 phosphorylation in invasive breast cancer.
20849385 Data show that STAT5A silencing evokes increased induction of apoptosis and enhanced sensitivity to imatinib, therefore making it important for leukemic cell survival.
20716621 Observational study of gene-disease association. (HuGE Navigator)
20530519 Observational study of gene-disease association. (HuGE Navigator)
20508164 Stat5a serine 725 and 779 phosphorylation is a prerequisite for hematopoietic transformation.
20503287 Observational study of gene-disease association. (HuGE Navigator)
20489169 miR-222 acts as an antiangiogenic miRNA, by controlling STAT5A expression.
20438785 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20415542 STAT-5 may play an important role in the progression of HPV-mediated cervical cancer
20406964 Observational study of gene-disease association. (HuGE Navigator)
20388848 Findings suggest that STAT5a activity in immunologically active nonmalignant cells acts as molecular predictor for treated FL patients.
20339093 several proliferation-related genes were up-regulated by STAT5 independent of GATA1, whereas several erythroid differentiation-related genes were found to be GATA1 as well as STAT5 dependent
20331378 Observational study of gene-disease association. (HuGE Navigator)
20233708 Stat5 involvement in the induction of metastatic behavior of human prostate cancer cells in vitro and in vivo.
20214633 Usually where breast STAT5a is present, PRLR is reduced; without STAT5a PRLR becomes abundant. Breast lesions lacking both were tested immunohistochemically for PRLR isoforms. The intermediate isoform was essentially only detected in these lesions.
20196786 5-aza-dc can induce SHP1 expression and inhibit JAK2/STAT3/STAT5 signalling
20124477 Loss of prolactin-Stat5a signaling and concomitant upregulation of BCL6 may represent a regulatory switch facilitating undifferentiated histology and poor prognosis of breast cancer.
20113333 lack of spontaneous STAT3 and STAT5 activation and the normal response to TPO is unexpected as MPLW515L leads to constitutive receptor activation and hypersensitivity to TPO in experimental models
20065083 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19966185 STAT5A and STAT5B differentially regulate behavior of human mammary carcinoma cells.
19956772 there is a highly distinctive cytokine responses in STAT5 phosphorylation in both normal and leukemic stem/progenitor cells
19923221 Data indicate that ser/thr phosphorylation negatively regulates IL-2 receptor complex formation and JAK3/STAT5 activation, and that this regulation is counteracted by PP2A.
19864382 basal level of pSTAT5 in HIV viremic patient CD4(+) T cells was also increased, indicating a constitutive activation of the JAK/STAT5 pathway
19817957 Observational study of gene-disease association. (HuGE Navigator)
19797429 Bcl6 and STAT5 binding are inversely coordinated by the endogenous pulses of pituitary GH release, suggesting this male-specific transcriptional repressor modulates hepatic GH signaling to select STAT5 target genes
19779039 STAT5A/B directs GM-CSF signaling through the regulation of proliferation and survival genes.
19675167 Analysis of the common IL-2/IL-7 signaling pathway via STAT5 reveals impaired STAT5 phosphorylation in a transgenic mouse model of spontaneous autoimmunity.
19571317 ID1 promotes expansion and survival of primary erythroid cells and is a target of JAK2V617F-STAT5 signaling
19491198 Using a model system of paired breast cancer cell lines, we found that coactivation of STAT5 and STAT3 leads to decreased proliferation and increased sensitivity to the paclitaxel and vinorelbine compared with cells that have only STAT3 activation.
19423653 analysis of in vivo binding of STAT5 to growth hormone-regulated genes
19423540 Observational study of gene-disease association. (HuGE Navigator)
19362457 Focusing on how STAT5A work in concert with other transcription factors will hopefully provide a better mechanistic understanding of the pathogenesis of various autoimmune diseases.
19309697 The simultaneous analysis of small-angle X-ray scattering data measured at different concentrations of unphosphorylated human STAT5a core domain unambiguously identifies the simultaneous presence of a monomer and a dimer.
19276230 Existence of a negative feedback loop, whereby effects of GH may be dampened by free fatty acids inhibition of GH-dependent STAT5 phosphorylation.
19262752 importance of a regulatory subnetwork associated with PIP expression in which STAT5 appears as a potential transcriptional regulator
19258923 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19036881 The results indicate that c-Myb potentiates Stat5a-driven gene expression, possibly functioning as a Stat5a coactivator, in human breast cancer.
18838617 SHD1 is a novel cytokine-inducible negative feedback regulator of STAT5a.
18830265 STAT5 is recruited to phosphorylated tyrosine residues on the activated GM-CSF receptor, indicating that STAT5 signaling profile reflects juvenile myelomonocytic leukemia hypersensitivity to GM-CSF.
18779318 Induction of STAT5A activity in CD34(+) cells resulted in impaired myelopoiesis and induction of erythropoiesis, which was most pronounced at the highest STAT5A transactivation levels.
18660489 Observational study of gene-disease association. (HuGE Navigator)
18616510 Homoharringtonine affects the JAK2-STAT5 signal pathway through alteration of protein tyrosine kinase phosphorylation in acute myeloid leukemia cells
18483262 persistent activation of STAT1, STAT3, and STAT5 correlate with resistance to vorinostat in lymphoma cell lines
18460645 IL-3-mediated cell expansion and arterial morphogenesis rely on STAT5 activation
18436865 STAT5 downregulation in CD34+ cells promotes megakaryocytic development, whereas activation of STAT5 drives erythropoiesis
18378698 STAT5A and progesterone receptor are coordinately recruited to a distal enhancer of 11beta-HSD2 gene.
18296629 STAT5 and nuclear factor-kappaB pathways collaborate in HL genesis
18271926 signal transducer and activator of transcription 5A and Jak2 co-overexpression cooperatively reverses epithelial-mesenchymal transition and promotes differentiation in human breast cancer cells
18270368 activation of STAT5 sustains FOXP3 expression in both Treg and Teff cells and contribute to our understanding of how cytokines affect the expression of FOXP3
18172316 The work presented here provides the first evidence of synergy between AR and the prolactin signaling protein Stat5a/b in human prostate cancer cells.
18063684 The SRC-STAT5 pathway is essential for decidualization of estrogen-primed human endometrial stromal cells.
18023521 IL-2 selectively enhanced production of IL-10 in HOZOT primarily through activation of STAT5, which synergistically acts with NF-kappaB/NFAT activation, implying a novel regulatory mechanism of IL-10 production in Treg cells.
17938255 Following cell exposure to IL-15, phosphorylation of STAT5 was predominantly observed, whereas, following stimulation with IL-21, there was predominant STAT1 and STAT3 activation.
17922009 Acts as a key tumor suppressor by reciprocally inhibiting expression of oncogenic nucleophosmin (NPM)-anaplastic lymphoma kinase (ALK) in T-cell anaplastic large cell lymphomas.
17913706 Myc down-regulation is a mechanism to activate the Rb pathway in STAT5A-induced senescence
17867599 Mutations occur in Reed Sternberg cells and nuclear phospho-STAT5 accumulates in the cell nucleus.
17846080 after tyrosine phosphorylation, STAT5a accumulates in the nucleus because of its retention by DNA binding
17726024 the phosphorylation of Tyr(1077) on LepRb during receptor activation, substantiate the hypothalamic regulation of STAT5 and S6 by leptin, and define the alternate LepRb signaling pathways
17703412 Observational study of gene-disease association. (HuGE Navigator)
17666591 analysis of STAT5, CIS, and SOCS2 interactions with the growth hormone receptor
17639043 Observational study of gene-disease association. (HuGE Navigator)
17438530 ability of prolactin to activate Stat5 and activating protein-1 was inversely related in mammary cell lines
17376889 found 3 specific patterns of pSTAT-3 and pSTAT-5 expression: uniformly increased pSTAT-3 and pSTAT-5 expression in PV, increased pSTAT-3 and reduced pSTAT-5 expression in ET, and uniformly reduced pSTAT-3 and pSTAT-5 expression in IM.
17332243 constitutively activated naturally occurring STAT5 Delta present in the leukocytes of most HIV-positive individuals acts as a negative regulator of HIV expression.(STAT5 DELTA)
17332243 Silencing C-terminally truncated STAT5 expression by siRNA enhances HIV-1 RNA and p24 Gag expression in chronically HIV-infected U1 cell line
17330131 There is a major role for STAT5a in the differentiation of keratinocytes, where it contributes to involucrin expression by activating the PPARgamma signal.
17220171 Stat5 activation enhanced SMN2 promoter activity with increase in both full-length and deletion exon 7 SMN transcripts.
17214852 Found in in situ lesions. May play some role in the prognosis/invasion of extramammary Paget's disease.
17169805 VEGF-A, STAT5 and AKT are downregulated in acute myeloid leukemia blasts of patients treated with SU5416
17128418 inhibition of ITD/Flt3 activity did not prevent the phosphorylation of ERK, STAT5 or Akt in some primary AML cells. In parallel, in these cells, Flt3 and ERK or Akt cooperate to regulate cell survival
17038539 constitutively active Stat5 mutant forms a complex with the p85 subunit of phosphatidylinositol 3-kinase and the scaffolding adapter Gab2 in leukemic bone marrow cells, resulting in the activation of Akt/PKB, a crucial downstream target of PI3-K
17015686 To determine the prosurvival function of STAT3 vs STAT5 within the same tumor model, genes were profiled in STAT3- or STAT5-depleted human lymphoblastic lymphoma-derived cell line YT cells by apoptosis-specific microarrays
16973758 a negative cross talk between PR and Stat5a/GR may contribute to the physiological role of progesterone to repress lactogenic hormone induction of the beta-casein gene
16954437 Expression of Stat5 is helpful in selecting patients who may benefit from endocrine therapy in breast cancer.
16840779 Data show that STAT5 binds in vivo to the NCAM2 intron in the NKL natural killer cell line and that this binding is induced by cytokines that activate STAT5.
16804404 STAT5 has a role in steroid-resistant ulcerative colitis
16729043 STAT5 is a direct binding partner to EGFR and ErbB4.
16684963 In polycythemia vera JAK2(V617F) may induce endogenous erythroid colonies via the STAT5/Bcl-xL pathway.
16572323 Effect of signal transducer and activator of transcription 5 proteins on indomethacin-induced cell division inhibition in chronic myelogenous leukemia cells.
16532027 STAT5 activation specifically cooperates with the loss of p53 function in B-cell lymphomagenesis
16502315 STAT5A and STAT5B may play significant roles in the growth and the process of apoptosis of selected human cutaneous T-cell lymphoma cells.
16455947 down-modulation of C/EBPalpha is a prerequisite for STAT5-induced effects on self-renewal and myelopoiesis in human cord blood-derived stem/progenitor cells
16407271 Results suggest that the antiapoptotic effects of erythropoietin in neuronal cells require the combinatorial activation of multiple signaling pathways, including STAT5, AKT, and potentially MAP kinase.
16303247 Constitutive activation of Stat5A is associated with oral squamous cell carcinoma
16289657 Silencing C-terminally truncated STAT5 expression by siRNA enhances HIV-1 RNA and p24 Gag expression in chronically HIV-infected U1 cell line
16133357 The absence of STAT 5a in the abnormal breast epithelial cells may indicate a defect contributory to the abnormal state.
16115927 Study shows that active Stat5 distinguished prostate cancer patients whose disease is likely to progress earlier; therefore, active Stat5 may be a useful marker for selection of more individualized treatment.
15795318 Consistently, overexpression of a constitutive active STAT5A leads to anchorage-independent cell cycle progression. Therefore, integrin-dependent STAT5A activation controls IL-3-mediated proliferation.
15677474 Results indicate that SOCS-7 is a dysregulator of prolactin, leptin, and growth hormone signaling and that its mode of action is a variation of SOCS protein inhibition of cytokine-inducible STAT3 and 5-mediated signal transduction.
15652752 These data suggest that Stat5 tetramers are associated with leukemogenesis.
15611091 STAP-2/BKS is a modulator of STAT5-mediated signaling
15592524 an invasion-suppressive role of Stat5 in human breast cancer
15534001 nuclear localization of STAT5A and stimulation of the beta-casein promoter requires nuclear translocation of the ERBB4 intracellular domain 4ICD; binding of the two proteins at transcription factor target promoters results in activation of gene expression
15358227 STAT5 is involved in cytokine-mediated up-regulation of MIST gene expression.
15353555 STAT5A has a role in human hematopoietic stem and progenitor cell self-renewal and diverts differentiation to the erythroid lineage
15313458 Aberrant regulation of STAT5 has been observed in solid tumors as well as in patients with either chronic or acute myeloid leukemia [review].
15169792 Stat5 activity in human breast cancer correlates with favorable prognosis
15128421 Perturbation of STAT5a&b expression by addition of ODNs decreased proliferative potential of the CML and the AML blasts as well as enhanced their apoptosis
15063762 Observational study of gene-disease association. (HuGE Navigator)
15048088 IL-7 induced the death of DN STAT5 expressing 697 cells occurs through caspase-dependent and -independent mechanisms that both require mitochondrial activation.
15010467 diminished N-domain-mediated oligomerization affected transcriptional activation by both Stat1 and Stat5a/b in a promoter-specific manner.
14726409 In advanced arteriosclerotic lesions, the activation of the Tie2-mediated STAT5 signaling pathway may negatively regulate vessel growth.
14696092 Stat5a was nuclear localized and tyrosine phosphorylated in 59 of 78 (76%) breast cancers examined; 38 of 78 (49%) demonstrated Stat5a nuclear localization in more than 25% of the breast cancer cells within the adenocarcinomas.
14637146 We show that the association of STAT5 and LMW-PTP does not exclusively involve the phosphatase active site and phosphotyrosine residue of STAT5.
14597631 Stat5-mediated gene transcription requires binding of the coactivator of transcription CBP
12954634 STAT5, in concert with the glucocorticoid receptor, recruits a multifunctional coactivator complex to initiate the PRL-dependent transcription
12901872 Stat5 plays an important role in IFN-signaling and participates in the induction of Type I IFN-dependent responses.
12847485 Role of c-Jun-N-terminal kinase and signal transducer and activator of transcription 5 in regulation of eosinophil apoptosis by nitric oxide.
12605694 Silencing C-terminally truncated STAT5 expression by siRNA enhances HIV-1 RNA and p24 Gag expression in chronically HIV-infected U1 cell line
12393707 role during eosinophil differentiation using umbilical cord blood-derived CD34(+) cells
12377952 Signal transducer and activator of transcription (Stat)5a and Stat5b are critical for normal immune function.
12208876 NF-kappaB is recruited directly to the promoters of several target genes, including STAT5a
12198240 CPAP was found to augment Stat5-mediated transcription
12091337 Prostaglandin-E2 enhances EPO-mediated STAT5 transcriptional activity by serine phosphorylation of CREB.
11973644 constitutive activation of Stat5a may contribute to head and neck cancer cell proliferation.
11923474 increase in Cyclin D1 promoter activity is predominantly mediated by the Jak2/Stat5 signaling pathway. PRL induces Stat5a and 5b to bind to Cyclin D1 promoter
11867689 STAT5 isoform expression, GM-CSF-induced STAT5 activation, and STAT5 target-gene expression are altered significantly during monocyte/macrophage differentiation
11861304 substrates for calpain in in platelets[stat5protease]
11779872 To examine the roles of BCR/ABL-activated individual signaling molecules we inducibly expressed a dominant negative (DN) form of Ras, phosphatidylinositol 3-kinase, and STAT5 alone or in combination in p210 BCR/ABL-positive K562 cells.
11756417 Jak-Stat and PI 3-kinase activation pathways regulate the TPO-induced survival of megakaryocytic cells via Bcl-xL gene expression.
11485409 Silencing C-terminally truncated STAT5 expression by siRNA enhances HIV-1 RNA and p24 Gag expression in chronically HIV-infected U1 cell line

AA Sequence

MAGWIQAQQLQGDALRQMQVLYGQHFPIEVRHYLAQWIESQPWDAIDLDNPQDRAQATQLLEGLVQELQK      1 - 70
KAEHQVGEDGFLLKIKLGHYATQLQKTYDRCPLELVRCIRHILYNEQRLVREANNCSSPAGILVDAMSQK     71 - 140
HLQINQTFEELRLVTQDTENELKKLQQTQEYFIIQYQESLRIQAQFAQLAQLSPQERLSRETALQQKQVS    141 - 210
LEAWLQREAQTLQQYRVELAEKHQKTLQLLRKQQTIILDDELIQWKRRQQLAGNGGPPEGSLDVLQSWCE    211 - 280
KLAEIIWQNRQQIRRAEHLCQQLPIPGPVEEMLAEVNATITDIISALVTSTFIIEKQPPQVLKTQTKFAA    281 - 350
TVRLLVGGKLNVHMNPPQVKATIISEQQAKSLLKNENTRNECSGEILNNCCVMEYHQATGTLSAHFRNMS    351 - 420
LKRIKRADRRGAESVTEEKFTVLFESQFSVGSNELVFQVKTLSLPVVVIVHGSQDHNATATVLWDNAFAE    421 - 490
PGRVPFAVPDKVLWPQLCEALNMKFKAEVQSNRGLTKENLVFLAQKLFNNSSSHLEDYSGLSVSWSQFNR    491 - 560
ENLPGWNYTFWQWFDGVMEVLKKHHKPHWNDGAILGFVNKQQAHDLLINKPDGTFLLRFSDSEIGGITIA    561 - 630
WKFDSPERNLWNLKPFTTRDFSIRSLADRLGDLSYLIYVFPDRPKDEVFSKYYTPVLAKAVDGYVKPQIK    631 - 700
QVVPEFVNASADAGGSSATYMDQAPSPAVCPQAPYNMYPQNPDHVLDQDGEFDLDETMDVARHVEELLRR    701 - 770
PMDSLDSRLSPPAGLFTSARGSLS                                                  771 - 794
//

Text Mined References (291)

PMID Year Title
27077371 2016 Inhibition of the JAK/STAT Signaling Pathway in Regulatory T Cells Reveals a Very Dynamic Regulation of Foxp3 Expression.
27016479 2016 Serotonin suppresses ?-casein expression via PTP1B activation in human mammary epithelial cells.
26970274 2016 Prolactin inhibits a major tumor-suppressive function of wild type BRCA1.
26717567 2015 How Intrinsic Molecular Dynamics Control Intramolecular Communication in Signal Transducers and Activators of Transcription Factor STAT5.
26707639 2016 Pyrvinium selectively induces apoptosis of lymphoma cells through impairing mitochondrial functions and JAK2/STAT5.
26695634 2015 STAT-5 Regulates Transcription of the Topoisomerase II?-Binding Protein 1 (TopBP1) Gene To Activate the ATR Pathway and Promote Human Papillomavirus Replication.
26551078 2016 Nuclear staining of fgfr-2/stat-5 and runx-2 in mucinous breast cancer.
26387651 2015 Histone 3 Trimethylation of IGFBP-7 Gene Promoter by Expression of D5 Stat5a in Breast Epithelial Cells.
26362718 2015 Jak2-Stat5a/b Signaling Induces Epithelial-to-Mesenchymal Transition and Stem-Like Cell Properties in Prostate Cancer.
26260387 2015 The novel function of CD82 and its impact on BCL2L12 via AKT/STAT5 signal pathway in acute myelogenous leukemia cells.
26252941 2015 Diagnostic utility of phosphorylated signal transducer and activator of transcription 5 immunostaining in the diagnosis of mammary analogue secretory carcinoma of the salivary gland: A comparative study of salivary gland cancers.
26238487 2015 The Raf Kinase Inhibitor Sorafenib Inhibits JAK-STAT Signal Transduction in Human Immune Cells.
26146825 2015 The Status of STAT3 and STAT5 in Human Breast Atypical Ductal Hyperplasia.
26059451 2015 STAT5A regulates DNMT3A in CD34(+)/CD38(-) AML cells.
25953263 2015 Revealing genome-wide mRNA and microRNA expression patterns in leukemic cells highlighted "hsa-miR-2278" as a tumor suppressor for regain of chemotherapeutic imatinib response due to targeting STAT5A.
25896132 2015 Signal transducer and activator of transcription 3 and 5 regulate system Xc- and redox balance in human breast cancer cells.
25885255 2015 Src family kinases interfere with dimerization of STAT5A through a phosphotyrosine-SH2 domain interaction.
25773877 2015 Expressional STAT3/STAT5 Ratio is an Independent Prognostic Marker in Colon Carcinoma.
25769613 2015 ICOS:ICOS-ligand interaction is required for type 2 innate lymphoid cell function, homeostasis, and induction of airway hyperreactivity.
25736842 2015 STAT-5 is activated constitutively in T cells, B cells and monocytes from patients with primary Sjögren's syndrome.
25673709 2015 The acetyltransferase Tip60 is a critical regulator of the differentiation-dependent amplification of human papillomaviruses.
25552366 2015 Inhibition of Stat5a/b Enhances Proteasomal Degradation of Androgen Receptor Liganded by Antiandrogens in Prostate Cancer.
25509109 2013 [The STAT5 signaling in the expression of alpha-subunit of interleukin-2 receptor in human blood lymphocytes].
25470773 2015 Deletion of STAT5a/b in vascular smooth muscle abrogates the male bias in hypoxic pulmonary hypertension in mice: implications in the human disease.
25456130 2014 Regulation of Stat5 by FAK and PAK1 in Oncogenic FLT3- and KIT-Driven Leukemogenesis.
25416956 2014 A proteome-scale map of the human interactome network.
25373509 2015 ETV6/ARG oncoprotein confers autonomous cell growth by enhancing c-Myc expression via signal transducer and activator of transcription 5 activation in the acute promyelocytic leukemia cell line HT93A.
25352693 2014 Degradation of the transcription factors NF-?B, STAT3, and STAT5 is involved in Entamoeba histolytica-induced cell death in Caco-2 colonic epithelial cells.
25231404 2014 Calreticulin promotes migration and invasion of esophageal cancer cells by upregulating neuropilin-1 expression via STAT5A.
25205818 2014 Differential effects of STAT proteins on growth hormone-mediated IGF-I gene expression.
25092144 2015 NF-?B/STAT5/miR-155 network targets PU.1 in FLT3-ITD-driven acute myeloid leukemia.
25043756 2014 Dihydrotestosterone enhances castration-resistant prostate cancer cell proliferation through STAT5 activation via glucocorticoid receptor pathway.
24925029 2014 Inhibition of STAT5a by Naa10p contributes to decreased breast cancer metastasis.
24913037 2014 The transcriptional responsiveness of LKB1 to STAT-mediated signaling is differentially modulated by prolactin in human breast cancer cells.
24878107 2014 Association between STAT5 polymorphisms and glioblastoma risk in Han Chinese population.
24821571 2014 The NAMPT promoter is regulated by mechanical stress, signal transducer and activator of transcription 5, and acute respiratory distress syndrome-associated genetic variants.
24813920 2015 Sustained inhibition of STAT5, but not JAK2, is essential for TKI-induced cell death in chronic myeloid leukemia.
24753251 2014 Regulation of the interferon regulatory factor-8 (IRF-8) tumor suppressor gene by the signal transducer and activator of transcription 5 (STAT5) transcription factor in chronic myeloid leukemia.
24681953 2015 Persistent STAT5 activation in myeloid neoplasms recruits p53 into gene regulation.
24658140 2014 The mammalian-membrane two-hybrid assay (MaMTH) for probing membrane-protein interactions in human cells.
24608043 2014 Role of C9orf140 in the promotion of colorectal cancer progression and mechanisms of its upregulation via activation of STAT5, ?-catenin and EZH2.
24587342 2014 FRA2 is a STAT5 target gene regulated by IL-2 in human CD4 T cells.
24523507 2014 Cutaneous T cell lymphoma expresses immunosuppressive CD80 (B7-1) cell surface protein in a STAT5-dependent manner.
24497979 2014 Identification of STAT5A and STAT5B target genes in human T cells.
24384092 2014 An N-terminal splice variant of human Stat5a that interacts with different transcription factors is the dominant form expressed in invasive ductal carcinoma.
24376517 2013 Inflammation regulates TMPRSS6 expression via STAT5.
24335105 2014 Constitutive activation of STAT5A and STAT5B regulates IgM secretion in Waldenstrom's macroglobulinemia.
24263804 2014 PAK-dependent STAT5 serine phosphorylation is required for BCR-ABL-induced leukemogenesis.
24204704 2013 Persistent STAT5 phosphorylation and epigenetic dysregulation of GM-CSF and PGS2/COX2 expression in Type 1 diabetic human monocytes.
24155890 2013 Identification of a STAT5 target gene, Dpf3, provides novel insights in chronic lymphocytic leukemia.
24135280 2013 EGFR phosphorylates tumor-derived EGFRvIII driving STAT3/5 and progression in glioblastoma.
24068731 2014 STAT5 polarization promotes iTregs and suppresses human T-cell alloresponses while preserving CTL capacity.
24040307 2013 Pim-1 kinase phosphorylates and stabilizes 130 kDa FLT3 and promotes aberrant STAT5 signaling in acute myeloid leukemia with FLT3 internal tandem duplication.
24004716 2013 Prolactin-Stat5 signaling in breast cancer is potently disrupted by acidosis within the tumor microenvironment.
23773921 2013 Differentiating the roles of STAT5B and STAT5A in human CD4+ T cells.
23733954 2013 Unphosphorylated STAT5A stabilizes heterochromatin and suppresses tumor growth.
23729680 2013 STAT5 and prolactin participate in a positive autocrine feedback loop that promotes angiogenesis.
23716595 2013 STAT5 outcompetes STAT3 to regulate the expression of the oncogenic transcriptional modulator BCL6.
23660011 2013 STAT5A/B gene locus undergoes amplification during human prostate cancer progression.
23621408 2013 Interleukin (IL)-31 activates signal transducer and activator of transcription (STAT)-1, STAT-5 and extracellular signal-regulated kinase 1/2 and down-regulates IL-12p40 production in activated human macrophages.
23593005 2013 The JAK-STAT transcriptional regulator, STAT-5, activates the ATM DNA damage pathway to induce HPV 31 genome amplification upon epithelial differentiation.
23465551 2014 Interference of propofol with signal transducer and activator of transcription 5 activation and cardioprotection by remote ischemic preconditioning during coronary artery bypass grafting.
23458731 2012 STAT5 triggers BCR-ABL1 mutation by mediating ROS production in chronic myeloid leukaemia.
23438599 2013 Fyn regulates adipogenesis by promoting PIKE-A/STAT5a interaction.
23406773 2013 Molecular pathways: Jak/STAT pathway: mutations, inhibitors, and resistance.
23332799 2013 Role of arachidonic acid metabolism in Stat5 activation induced by oleic acid in MDA-MB-231 breast cancer cells.
23262295 2013 The upregulation of signal transducer and activator of transcription 5-dependent microRNA-182 and microRNA-96 promotes ovarian cancer cell proliferation by targeting forkhead box O3 upon leptin stimulation.
23243289 2013 FACS analysis of Stat3/5 signaling reveals sensitivity to G-CSF and IL-6 as a significant prognostic factor in pediatric AML: a Children's Oncology Group report.
23223023 2013 Increase of palmitic acid concentration impairs endothelial progenitor cell and bone marrow-derived progenitor cell bioavailability: role of the STAT5/PPAR? transcriptional complex.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23161573 2012 Stat5 in breast cancer: potential oncogenic activity coincides with positive prognosis for the disease.
23151802 2013 Definitive evidence using enucleated cytoplasts for a nongenomic basis for the cystic change in endoplasmic reticulum structure caused by STAT5a/b siRNAs.
23134344 2012 Overexpression of signal transducer and activator of transcription (STAT-3 and STAT-5) transcription factors and alteration of suppressor of cytokine signaling (SOCS-1) protein in prostate cancer.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
23111066 2013 Histone deacetylases inhibitor sodium butyrate inhibits JAK2/STAT signaling through upregulation of SOCS1 and SOCS3 mediated by HDAC8 inhibition in myeloproliferative neoplasms.
23036105 2012 Low levels of Stat5a protein in breast cancer are associated with tumor progression and unfavorable clinical outcomes.
22926520 2013 Src family kinases mediate cytoplasmic retention of activated STAT5 in BCR-ABL-positive cells.
22781567 2012 [Expression of phosphorylated STAT5 in bone marrow hematopoietic stem cells of patients with paroxysmal nocturnal hemoglobinuria before and after in vitro G-CSF or SCF stimulation].
22753752 2012 Enalapril-induced apoptosis of acute promyelocytic leukaemia cells involves STAT5A.
22367509 2012 STAT5a-targeting miRNA enhances chemosensitivity to cisplatin and 5-fluorouracil in human colorectal cancer cells.
22196377 2012 Influence of TRAF1/C5 and STAT4 genes polymorphisms on susceptibility and severity of rheumatoid arthritis in Egyptian population.
22159083 2012 Nongenomic STAT5-dependent effects on Golgi apparatus and endoplasmic reticulum structure and function.
22065720 2012 Activated STAT5 promotes long-lived cytotoxic CD8+ T cells that induce regression of autochthonous melanoma.
22046434 2011 Overexpression of a minimal domain of calpastatin suppresses IL-6 production and Th17 development via reduced NF-?B and increased STAT5 signals.
21826656 2012 STAT5 isoforms regulate colorectal cancer cell apoptosis via reduction of mitochondrial membrane potential and generation of reactive oxygen species.
21816901 2011 HMGN2 inducibly binds a novel transactivation domain in nuclear PRLr to coordinate Stat5a-mediated transcription.
21785216 2011 Prolactin increases SMN expression and survival in a mouse model of severe spinal muscular atrophy via the STAT5 pathway.
21749449 2011 The JAK2V617F allele burden and STAT3- and STAT5 phosphorylation in myeloproliferative neoplasms: early prefibrotic myelofibrosis compared with essential thrombocythemia, polycythemia vera and myelofibrosis.
21704724 2011 Signal transducer and activator of transcription 5a/b: biomarker and therapeutic target in prostate and breast cancer.
21698228 2011 Productive parvovirus B19 infection of primary human erythroid progenitor cells at hypoxia is regulated by STAT5A and MEK signaling but not HIF?.
21619451 2011 Flow cytometric analysis of STAT5 phosphorylation and CD95 expression in CD4+ T lymphocytes treated with recombinant human erythropoietin.
21606506 2011 Ebf1 or Pax5 haploinsufficiency synergizes with STAT5 activation to initiate acute lymphoblastic leukemia.
21602494 2011 Tight control of STAT5 activity determines human CD34-derived interstitial dendritic cell and langerhans cell development.
21542777 2012 Peroxisome proliferator-activated receptor gamma/signal transducers and activators of transcription 5A pathway plays a key factor in adipogenesis of human bone marrow-derived stromal cells and 3T3-L1 preadipocytes.
21531896 2011 Papillomavirus-specific CD4+ T cells exhibit reduced STAT-5 signaling and altered cytokine profiles in patients with recurrent respiratory papillomatosis.
21464042 2011 Interaction between FGFR-2, STAT5, and progesterone receptors in breast cancer.
21269460 2011 Initial characterization of the human central proteome.
21263150 2011 Identification of HIF2alpha as an important STAT5 target gene in human hematopoietic stem cells.
21233313 2011 The STAT5 inhibitor pimozide decreases survival of chronic myelogenous leukemia cells resistant to kinase inhibitors.
21220747 2011 High STAT5 levels mediate imatinib resistance and indicate disease progression in chronic myeloid leukemia.
21135090 2011 Mechanisms of STAT protein activation by oncogenic KIT mutants in neoplastic mast cells.
21079973 2011 Expression of phosphorylated Stat5 predicts expression of cyclin D1 and correlates with poor prognosis of colonic adenocarcinoma.
20974963 2010 Thymic stromal lymphopoietin-mediated STAT5 phosphorylation via kinases JAK1 and JAK2 reveals a key difference from IL-7-induced signaling.
20952588 2010 PTP1B suppresses prolactin activation of Stat5 in breast cancer cells.
20849385 2010 Suppression of STAT5A increases chemotherapeutic sensitivity in imatinib-resistant and imatinib-sensitive K562 cells.
20716621 2010 Genetic polymorphisms in adaptive immunity genes and childhood acute lymphoblastic leukemia.
20530519 2010 Interleukin 4 and STAT6 gene polymorphisms are associated with systemic lupus erythematosus in Chinese patients.
20508164 2010 Stat5a serine 725 and 779 phosphorylation is a prerequisite for hematopoietic transformation.
20503287 2010 Interleukin-9 polymorphism in infants with respiratory syncytial virus infection: an opposite effect in boys and girls.
20489169 2010 microRNA-222 controls neovascularization by regulating signal transducer and activator of transcription 5A expression.
20438785 2010 Polymorphisms in innate immunity genes and risk of childhood leukemia.
20415542 2010 Deregulation of STAT-5 isoforms in the development of HPV-mediated cervical carcinogenesis.
20406964 2010 Risk of meningioma and common variation in genes related to innate immunity.
20388848 2010 Signal transducers and activators of transcription 5a-dependent cross-talk between follicular lymphoma cells and tumor microenvironment characterizes a group of patients with improved outcome after R-CHOP.
20339093 2010 Down-regulation of GATA1 uncouples STAT5-induced erythroid differentiation from stem/progenitor cell proliferation.
20331378 2010 Large-scale candidate gene analysis of spontaneous clearance of hepatitis C virus.
20233708 2010 Stat5 promotes metastatic behavior of human prostate cancer cells in vitro and in vivo.
20214633 2010 Cells with minimal expression of the JAK/STAT pathway related proteins STAT5a and the prolactin receptor: evidence of an alternate prolactin receptor isoform in breast disease.
20196786 2009 Inhibition of DNA methyltransferase induces G2 cell cycle arrest and apoptosis in human colorectal cancer cells via inhibition of JAK2/STAT3/STAT5 signalling.
20124477 2010 Prolactin inhibits BCL6 expression in breast cancer through a Stat5a-dependent mechanism.
20113333 2010 Screening for MPL mutations in essential thrombocythemia and primary myelofibrosis: normal Mpl expression and absence of constitutive STAT3 and STAT5 activation in MPLW515L-positive platelets.
20075866 2010 PIKE-A is required for prolactin-mediated STAT5a activation in mammary gland development.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
20065083 2010 A polymorphism associated with STAT3 expression and response of chronic myeloid leukemia to interferon ?.
19966185 2010 Signal transducer and activator of transcription (STAT)-5A and STAT5B differentially regulate human mammary carcinoma cell behavior.
19956772 2009 Single-cell STAT5 signal transduction profiling in normal and leukemic stem and progenitor cell populations reveals highly distinct cytokine responses.
19923221 2010 Protein phosphatase 2A regulates interleukin-2 receptor complex formation and JAK3/STAT5 activation.
19864382 2010 Dual mechanism of impairment of interleukin-7 (IL-7) responses in human immunodeficiency virus infection: decreased IL-7 binding and abnormal activation of the JAK/STAT5 pathway.
19817957 2009 Secreted protein acidic and rich in cysteine (SPARC) gene polymorphism association with hepatocellular carcinoma in Italian patients.
19797429 2009 Male-specific hepatic Bcl6: growth hormone-induced block of transcription elongation in females and binding to target genes inversely coordinated with STAT5.
19779039 2009 The transcription factors STAT5A/B regulate GM-CSF-mediated granulopoiesis.
19675167 2009 Self-peptides prolong survival in murine autoimmunity via reduced IL-2/IL-7-mediated STAT5 signaling, CD8 coreceptor, and V alpha 2 down-regulation.
19571317 2009 ID1 promotes expansion and survival of primary erythroid cells and is a target of JAK2V617F-STAT5 signaling.
19491198 2009 Reciprocal effects of STAT5 and STAT3 in breast cancer.
19423653 2009 Dynamic in vivo binding of STAT5 to growth hormone-regulated genes in intact rat liver. Sex-specific binding at low- but not high-affinity STAT5 sites.
19423540 2009 Common variation in genes related to innate immunity and risk of adult glioma.
19362457 2009 The Current STATus of lymphocyte signaling: new roles for old players.
19309697 2009 Structural characterization of unphosphorylated STAT5a oligomerization equilibrium in solution by small-angle X-ray scattering.
19276230 2009 Free fatty acids inhibit growth hormone/signal transducer and activator of transcription-5 signaling in human muscle: a potential feedback mechanism.
19262752 2009 A functional and regulatory network associated with PIP expression in human breast cancer.
19258923 2009 Genetic susceptibility to respiratory syncytial virus bronchiolitis in preterm children is associated with airway remodeling genes and innate immune genes.
19036881 2009 Role of c-Myb during prolactin-induced signal transducer and activator of transcription 5a signaling in breast cancer cells.
18838617 2009 SHD1 is a novel cytokine-inducible, negative feedback regulator of STAT5-dependent transcription.
18830265 2009 Aberrant GM-CSF signal transduction pathway in juvenile myelomonocytic leukemia assayed by flow cytometric intracellular STAT5 phosphorylation measurement.
18779318 2008 Maximal STAT5-induced proliferation and self-renewal at intermediate STAT5 activity levels.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18660489 2008 Multiple genetic variants along candidate pathways influence plasma high-density lipoprotein cholesterol concentrations.
18616510 2008 Homoharringtonine affects the JAK2-STAT5 signal pathway through alteration of protein tyrosine kinase phosphorylation in acute myeloid leukemia cells.
18483262 2008 Constitutive activation of signal transducers and activators of transcription predicts vorinostat resistance in cutaneous T-cell lymphoma.
18460645 2008 Interleukin-3 promotes expansion of hemopoietic-derived CD45+ angiogenic cells and their arterial commitment via STAT5 activation.
18436865 2008 Downregulation of signal transducer and activator of transcription 5 (STAT5) in CD34+ cells promotes megakaryocytic development, whereas activation of STAT5 drives erythropoiesis.
18378698 2008 Progesterone induction of the 11beta-hydroxysteroid dehydrogenase type 2 promoter in breast cancer cells involves coordinated recruitment of STAT5A and progesterone receptor to a distal enhancer and polymerase tracking.
18296629 2008 IL-21 is expressed in Hodgkin lymphoma and activates STAT5: evidence that activated STAT5 is required for Hodgkin lymphomagenesis.
18271926 2008 Co-overexpression of Janus kinase 2 and signal transducer and activator of transcription 5a promotes differentiation of mammary cancer cells through reversal of epithelial-mesenchymal transition.
18270368 2008 STAT5-signaling cytokines regulate the expression of FOXP3 in CD4+CD25+ regulatory T cells and CD4+CD25- effector T cells.
18172316 2008 Transcription factor Stat5 synergizes with androgen receptor in prostate cancer cells.
18063684 2008 Activation of SRC kinase and phosphorylation of signal transducer and activator of transcription-5 are required for decidual transformation of human endometrial stromal cells.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
18023521 2008 IL-2 activation of STAT5 enhances production of IL-10 from human cytotoxic regulatory T cells, HOZOT.
17938255 2008 The opposite effects of IL-15 and IL-21 on CLL B cells correlate with differential activation of the JAK/STAT and ERK1/2 pathways.
17922009 2007 STAT5A is epigenetically silenced by the tyrosine kinase NPM1-ALK and acts as a tumor suppressor by reciprocally inhibiting NPM1-ALK expression.
17913706 2007 Myc down-regulation as a mechanism to activate the Rb pathway in STAT5A-induced senescence.
17867599 2006 [Mutations of the tumor suppressor gene SOCS-1 in classical Hodgkin lymphoma are frequent and associated with nuclear phospho-STAT5 accumulation].
17846080 2008 Constitutive nuclear import of latent and activated STAT5a by its coiled coil domain.
17726024 2007 The long form of the leptin receptor regulates STAT5 and ribosomal protein S6 via alternate mechanisms.
17703412 2007 Genetic susceptibility to respiratory syncytial virus bronchiolitis is predominantly associated with innate immune genes.
17666591 2007 Mammalian protein-protein interaction trap (MAPPIT) analysis of STAT5, CIS, and SOCS2 interactions with the growth hormone receptor.
17639043 2007 Polymorphisms in the Janus kinase 2 (JAK)/signal transducer and activator of transcription (STAT) genes: putative association of the STAT gene region with familial breast cancer.
17438530 2007 Stat5 activation inhibits prolactin-induced AP-1 activity: distinct prolactin-initiated signals in tumorigenesis dependent on cell context.
17376889 2007 Different STAT-3 and STAT-5 phosphorylation discriminates among Ph-negative chronic myeloproliferative diseases and is independent of the V617F JAK-2 mutation.
17332243 2007 Naturally occurring C-terminally truncated STAT5 is a negative regulator of HIV-1 expression.
17330131 2007 STAT5a/PPARgamma pathway regulates involucrin expression in keratinocyte differentiation.
17220171 2007 Stat5 constitutive activation rescues defects in spinal muscular atrophy.
17214852 2007 Expression and prognostic significance of Stat5a and E-cadherin in extramammary Paget's disease.
17169805 2006 Downregulation of VEGF-A, STAT5 and AKT in acute myeloid leukemia blasts of patients treated with SU5416.
17128418 2007 Inhibition of Flt3-activating mutations does not prevent constitutive activation of ERK/Akt/STAT pathways in some AML cells: a possible cause for the limited effectiveness of monotherapy with small-molecule inhibitors.
17081983 2006 Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.
17038539 2007 Constitutive activation of Stat5 promotes its cytoplasmic localization and association with PI3-kinase in myeloid leukemias.
17015686 2006 A preferential role for STAT5, not constitutively active STAT3, in promoting survival of a human lymphoid tumor.
16973758 2007 Progesterone receptor repression of prolactin/signal transducer and activator of transcription 5-mediated transcription of the beta-casein gene in mammary epithelial cells.
16954437 2006 Stat5 expression predicts response to endocrine therapy and improves survival in estrogen receptor-positive breast cancer.
16840779 2006 Identification of human STAT5-dependent gene regulatory elements based on interspecies homology.
16819511 2007 STAT5 represses BCL6 expression by binding to a regulatory region frequently mutated in lymphomas.
16804404 2006 A role for STAT5 in steroid-resistant UC?
16729043 2005 Phosphotyrosine interactome of the ErbB-receptor kinase family.
16684963 2006 Constitutive activation of STAT5 and Bcl-xL overexpression can induce endogenous erythroid colony formation in human primary cells.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
16572323 2006 Antiproliferative effect of indomethacin on CML cells is related to the suppression of STATs/Bcl-XL signal pathway.
16532027 2006 Constitutive STAT5 activation specifically cooperates with the loss of p53 function in B-cell lymphomagenesis.
16502315 2006 The influence of STAT5 antisense oligodeoxynucleotides on the proliferation and apoptosis of selected human cutaneous T-cell lymphoma cell lines.
16476059 2006 CTLA-4 interacts with STAT5 and inhibits STAT5-mediated transcription.
16455947 2006 STAT5-induced self-renewal and impaired myelopoiesis of human hematopoietic stem/progenitor cells involves down-modulation of C/EBPalpha.
16407271 2006 Antiapoptotic effects of erythropoietin in differentiated neuroblastoma SH-SY5Y cells require activation of both the STAT5 and AKT signaling pathways.
16303247 2006 Expression of Stat5A in tobacco chewing-mediated oral squamous cell carcinoma.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
16133357 2006 STAT 5a expression in various lesions of the breast.
16115927 2005 Activation of signal transducer and activator of transcription-5 in prostate cancer predicts early recurrence.
15795318 2005 {beta}1 Integrin and IL-3R coordinately regulate STAT5 activation and anchorage-dependent proliferation.
15677474 2005 Suppressor of cytokine signaling 7 inhibits prolactin, growth hormone, and leptin signaling by interacting with STAT5 or STAT3 and attenuating their nuclear translocation.
15652752 2005 Stat5 tetramer formation is associated with leukemogenesis.
15611091 2005 Physical and functional interactions between STAP-2/BKS and STAT5.
15592524 2005 Stat5 promotes homotypic adhesion and inhibits invasive characteristics of human breast cancer cells.
15588985 2005 Substrate-trapping techniques in the identification of cellular PTP targets.
15534001 2004 The ERBB4/HER4 receptor tyrosine kinase regulates gene expression by functioning as a STAT5A nuclear chaperone.
15526160 2004 Signal transduction via the stem cell factor receptor/c-Kit.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15358227 2004 Transcriptional regulation of SLP-76 family hematopoietic cell adaptor MIST/Clnk by STAT5.
15353555 2004 Constitutive activation of STAT5A promotes human hematopoietic stem cell self-renewal and erythroid differentiation.
15313458 2004 Signal transducer and activator of transcription 5 (STAT5).
15304355 2004 ERalpha and STAT5a cross-talk: interaction through C-terminal portions of the proteins decreases STAT5a phosphorylation, nuclear translocation and DNA-binding.
15169792 2004 Signal transducer and activator of transcription-5 activation and breast cancer prognosis.
15128421 2004 The role of the STAT5 proteins in the proliferation and apoptosis of the CML and AML cells.
15063762 2004 Genetic variations in humans associated with differences in the course of hepatitis C.
15048088 2004 Interleukin-7 induces apoptosis of 697 pre-B cells expressing dominant-negative forms of STAT5: evidence for caspase-dependent and -independent mechanisms.
15010467 2004 A single residue modulates tyrosine dephosphorylation, oligomerization, and nuclear accumulation of stat transcription factors.
14726487 2004 Distinct components of Janus kinase/signal transducer and activator of transcription signaling pathway mediate the regulation of systemic and tissue localized renin-angiotensin system.
14726409 2004 Angiopoietin 2 induces cell cycle arrest in endothelial cells: a possible mechanism involved in advanced plaque neovascularization.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14696092 2004 Stat5a is tyrosine phosphorylated and nuclear localized in a high proportion of human breast cancers.
14645506 2003 STAT5 and Oct-1 form a stable complex that modulates cyclin D1 expression.
14637146 2003 LMW-PTP associates and dephosphorylates STAT5 interacting with its C-terminal domain.
14597631 2004 The coactivator of transcription CREB-binding protein interacts preferentially with the glycosylated form of Stat5.
14504097 2004 FLT3 mutations in the activation loop of tyrosine kinase domain are frequently found in infant ALL with MLL rearrangements and pediatric ALL with hyperdiploidy.
12954634 2003 NCoA-1/SRC-1 is an essential coactivator of STAT5 that binds to the FDL motif in the alpha-helical region of the STAT5 transactivation domain.
12901872 2003 Role of Stat5 in type I interferon-signaling and transcriptional regulation.
12847485 2003 Regulation of eosinophil apoptosis by nitric oxide: Role of c-Jun-N-terminal kinase and signal transducer and activator of transcription 5.
12529425 2003 STAT5a activation mediates the epithelial to mesenchymal transition induced by oncogenic RhoA.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12459499 2002 BRCA1 and BRCA2 bind Stat5a and suppress its transcriptional activity.
12456798 2002 Dual mechanism of signal transducer and activator of transcription 5 activation by the insulin receptor.
12393707 2003 Signal transducer and activator of transcription 5a (STAT5a) is required for eosinophil differentiation of human cord blood-derived CD34+ cells.
12377952 2002 Interleukin-2 family cytokines stimulate phosphorylation of the Pro-Ser-Pro motif of Stat5 transcription factors in human T cells: resistance to suppression of multiple serine kinase pathways.
12237455 2002 The SPOT technique as a tool for studying protein tyrosine phosphatase substrate specificities.
12208876 2002 Nuclear factor kappaB-dependent gene expression profiling of Hodgkin's disease tumor cells, pathogenetic significance, and link to constitutive signal transducer and activator of transcription 5a activity.
12198240 2002 CPAP is a novel stat5-interacting cofactor that augments stat5-mediated transcriptional activity.
12193575 2002 c-Cbl is a negative regulator of GH-stimulated STAT5-mediated transcription.
12091337 2002 Prostaglandin-E2 enhances EPO-mediated STAT5 transcriptional activity by serine phosphorylation of CREB.
12060651 2002 Prolactin induces SHP-2 association with Stat5, nuclear translocation, and binding to the beta-casein gene promoter in mammary cells.
12039059 2002 The structure of human STAT5A and B genes reveals two regions of nearly identical sequence and an alternative tissue specific STAT5B promoter.
12039028 2002 Signaling through the JAK/STAT pathway, recent advances and future challenges.
11997457 2002 The intranuclear prolactin/cyclophilin B complex as a transcriptional inducer.
11923474 2002 PRL activates the cyclin D1 promoter via the Jak2/Stat pathway.
11867689 2002 Granulocyte-macrophage colony-stimulating factor (GM-CSF)-induced STAT5 activation and target-gene expression during human monocyte/macrophage differentiation.
11861304 2002 Calpain is a signal transducer and activator of transcription (STAT) 3 and STAT5 protease.
11779872 2002 Functional cooperation among Ras, STAT5, and phosphatidylinositol 3-kinase is required for full oncogenic activities of BCR/ABL in K562 cells.
11773439 2002 A nuclear protein tyrosine phosphatase TC-PTP is a potential negative regulator of the PRL-mediated signaling pathway: dephosphorylation and deactivation of signal transducer and activator of transcription 5a and 5b by TC-PTP in nucleus.
11756417 2002 Thrombopoietin regulates Bcl-xL gene expression through Stat5 and phosphatidylinositol 3-kinase activation pathways.
11726519 2001 Functional interaction of STAT5 and nuclear receptor co-repressor SMRT: implications in negative regulation of STAT5-dependent transcription.
11722592 2001 Constitutive activation of STAT transcription factors in acute myelogenous leukemia.
11682624 2001 Cross-talk between ERs and signal transducer and activator of transcription 5 is E2 dependent and involves two functionally separate mechanisms.
11440634 2001 Involvement of protein phosphatase 2A in the interleukin-3-stimulated Jak2-Stat5 signaling pathway.
11418668 2001 Human thymic stromal lymphopoietin preferentially stimulates myeloid cells.
11418623 2001 Cutting edge: the common gamma-chain is an indispensable subunit of the IL-21 receptor complex.
11413148 2001 Transcription factor STAT5A is a substrate of Bruton's tyrosine kinase in B cells.
11167825 2001 Engagement of the CrkL adaptor in interferon alpha signalling in BCR-ABL-expressing cells.
11158330 2001 Cooperative effects of STAT5 (signal transducer and activator of transcription 5) and C/EBPbeta (CCAAT/enhancer-binding protein-beta) on beta-casein gene transcription are mediated by the glucocorticoid receptor.
11097834 2000 Thrombopoietin and interleukin-2 induce association of CRK with STAT5.
11030348 2000 Stat5 is essential for the myelo- and lymphoproliferative disease induced by TEL/JAK2.
10996427 2000 Growth hormone (GH) induces the formation of protein complexes involving Stat5, Erk2, Shc and serine phosphorylated proteins.
10825200 2000 Hierarchy of protein tyrosine kinases in interleukin-2 (IL-2) signaling: activation of syk depends on Jak3; however, neither Syk nor Lck is required for IL-2-mediated STAT activation.
10652277 2000 Antiapoptotic activity of Stat5 required during terminal stages of myeloid differentiation.
10617656 2000 Cytosolic tyrosine dephosphorylation of STAT5. Potential role of SHP-2 in STAT5 regulation.
10602027 2000 Association of STAT1, STAT3 and STAT5 proteins with the IL-2 receptor involves different subdomains of the IL-2 receptor beta chain.
10594041 2000 DNA binding site selection of dimeric and tetrameric Stat5 proteins reveals a large repertoire of divergent tetrameric Stat5a binding sites.
10570284 1999 Requirement for stat5 in thymic stromal lymphopoietin-mediated signal transduction.
10428030 1999 Fetal anemia and apoptosis of red cell progenitors in Stat5a-/-5b-/- mice: a direct role for Stat5 in Bcl-X(L) induction.
10358079 1999 ErbB receptor-induced activation of stat transcription factors is mediated by Src tyrosine kinases.
10358045 1999 STAT protein recruitment and activation in c-Kit deletion mutants.
10194762 1999 Extracellular signal-regulated kinase (ERK) interacts with signal transducer and activator of transcription (STAT) 5a.
10037796 1999 Similarities and differences in RANTES- and (AOP)-RANTES-triggered signals: implications for chemotaxis.
10037026 1999 Differential substrate recognition capabilities of Janus family protein tyrosine kinases within the interleukin 2 receptor (IL2R) system: Jak3 as a potential molecular target for treatment of leukemias with a hyperactive Jak-Stat signaling machinery.
9989503 1999 Functional association of Nmi with Stat5 and Stat1 in IL-2- and IFNgamma-mediated signaling.
9880255 1999 STAT5 interaction with the T cell receptor complex and stimulation of T cell proliferation.
9837784 1998 Association of CrkL with STAT5 in hematopoietic cells stimulated by granulocyte-macrophage colony-stimulating factor or erythropoietin.
9575217 1998 Jak2-Stat5 interactions analyzed in yeast.
9528750 1998 Characterization of Stat5a and Stat5b homodimers and heterodimers and their association with the glucocortiocoid receptor in mammary cells.
9484840 1998 Activation of Stat5 by platelet-derived growth factor (PDGF) is dependent on phosphorylation sites in PDGF beta-receptor juxtamembrane and kinase insert domains.
9398404 1997 IL-2 and IL-7 induce heterodimerization of STAT5 isoforms in human peripheral blood T lymphoblasts.
9373245 1997 The Bmx tyrosine kinase induces activation of the Stat signaling pathway, which is specifically inhibited by protein kinase Cdelta.
9122188 1997 Stat5 is a physiological substrate of the insulin receptor.
9047382 1997 An alternative pathway for STAT activation that is mediated by the direct interaction between JAK and STAT.
9030599 1997 A single STAT recruitment module in a chimeric cytokine receptor complex is sufficient for STAT activation.
8977232 1996 Physical and functional interactions between Stat5 and the tyrosine-phosphorylated receptors for erythropoietin and interleukin-3.
8878484 1996 Functional interactions between Stat5 and the glucocorticoid receptor.
8732682 1996 Characterization and cloning of STAT5 from IM-9 cells and its activation by growth hormone.
8702683 1996 Growth hormone promotes the association of transcription factor STAT5 with the growth hormone receptor.
8631883 1996 Cloning of human Stat5B. Reconstitution of interleukin-2-induced Stat5A and Stat5B DNA binding activity in COS-7 cells.
8617237 1996 Interleukin-2 activation of STAT5 requires the convergent action of tyrosine kinases and a serine/threonine kinase pathway distinct from the Raf1/ERK2 MAP kinase pathway.
7925280 1994 Prolactin induces phosphorylation of Tyr694 of Stat5 (MGF), a prerequisite for DNA binding and induction of transcription.
7719938 1995 The role of shared receptor motifs and common Stat proteins in the generation of cytokine pleiotropy and redundancy by IL-2, IL-4, IL-7, IL-13, and IL-15.
7719937 1995 Identification and purification of human Stat proteins activated in response to interleukin-2.