Property Summary

NCBI Gene PubMed Count 260
Grant Count 583
R01 Count 378
Funding $43,655,227.86
PubMed Score 736.93
PubTator Score 401.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma -1.300 0.000
psoriasis -1.600 0.000
osteosarcoma -1.894 0.000
atypical teratoid / rhabdoid tumor 1.100 0.001
medulloblastoma, large-cell -1.400 0.000
juvenile dermatomyositis 1.054 0.000
intraductal papillary-mucinous neoplasm ... 1.200 0.005
lung cancer -3.000 0.000
group 3 medulloblastoma -1.100 0.004
subependymal giant cell astrocytoma 1.668 0.017
COPD -1.100 0.006
lung carcinoma -1.600 0.000
invasive ductal carcinoma -1.200 0.002
ovarian cancer 1.600 0.000
Breast cancer -1.400 0.000

Synonym

Accession P42226 A8K316 B7ZA27 F5GXI9 Q5FBW5 Q71UP4
Symbols STAT6B
STAT6C
D12S1644
IL-4-STAT

Gene

PANTHER Protein Class (1)

PDB

1OJ5   4Y5U   4Y5W   5D39  

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
922 confirmatory 26 / 90 / 4 Confirmation Concentration-Response Assay for Identification of Small Molecule Antagonists of Stat Signaling Pathway
934 confirmatory 18 / 35 / 67 Parental Cell Counter Screen for Stat Signaling Pathway Assay
935 confirmatory 11 / 105 / 4 Confirmation Concentration-Response Assay for Identification of Small Molecule Agonists of Stat Signaling Pathway

Gene RIF (234)

PMID Text
26945968 These results suggest that STAT6 plays an important role in regulating Sp1 and BCL6 through STAT2 to exert the anti-proliferative effects of type I IFN.
26883114 This study confirms that meningeal Meningeal solitary fibrous tumor and hemangiopericytoma represent a histopathologic continuum linked by STAT6 nuclear expression and NAB2-STAT6 fusion similar to their soft tissue counterparts.
26829670 interleukin-4 regulates hematopoietic lineage choice by activating the JAK3-STAT6 pathway, which causes dendritic-cell-specific DNA demethylation
26817999 Case Report: NAB2-STAT6 fusion in glioblastoma.
26758199 A constitutively activated form of STAT6 is able to bypass IL-4 upstream signalling and instruct dendritic-cell-specific functional DNA methylation changes
26686340 the majority of intrathoracic SFTs exhibited STAT6 nuclear staining, and NAB2ex4-STAT6ex2/3 was the predominant fusion type.
26617768 Immunohistochemistry results indicate that combination with ALDH1 and STAT6 can improve the diagnostic value of CD34 for solitary fibrous tumors.
26461141 STAT6 is a direct target of miR-361-5p and promotes Bcl-xL expression.
26246572 IL-13/STAT6 signaling is modulated by Kaposi's sarcoma-associated herpesvirus to promote host cell proliferation and viral pathogenesis.
26226844 We delineate the common and rare NAB2-STAT6 fusion variants in solitary fibrous tumors
More...

AA Sequence

MSLWGLVSKMPPEKVQRLYVDFPQHLRHLLGDWLESQPWEFLVGSDAFCCNLASALLSDTVQHLQASVGE      1 - 70
QGEGSTILQHISTLESIYQRDPLKLVATFRQILQGEKKAVMEQFRHLPMPFHWKQEELKFKTGLRRLQHR     71 - 140
VGEIHLLREALQKGAEAGQVSLHSLIETPANGTGPSEALAMLLQETTGELEAAKALVLKRIQIWKRQQQL    141 - 210
AGNGAPFEESLAPLQERCESLVDIYSQLQQEVGAAGGELEPKTRASLTGRLDEVLRTLVTSCFLVEKQPP    211 - 280
QVLKTQTKFQAGVRFLLGLRFLGAPAKPPLVRADMVTEKQARELSVPQGPGAGAESTGEIINNTVPLENS    281 - 350
IPGNCCSALFKNLLLKKIKRCERKGTESVTEEKCAVLFSASFTLGPGKLPIQLQALSLPLVVIVHGNQDN    351 - 420
NAKATILWDNAFSEMDRVPFVVAERVPWEKMCETLNLKFMAEVGTNRGLLPEHFLFLAQKIFNDNSLSME    421 - 490
AFQHRSVSWSQFNKEILLGRGFTFWQWFDGVLDLTKRCLRSYWSDRLIIGFISKQYVTSLLLNEPDGTFL    491 - 560
LRFSDSEIGGITIAHVIRGQDGSPQIENIQPFSAKDLSIRSLGDRIRDLAQLKNLYPKKPKDEAFRSHYK    561 - 630
PEQMGKDGRGYVPATIKMTVERDQPLPTPELQMPTMVPSYDLGMAPDSSMSMQLGPDMVPQVYPPHSHSI    631 - 700
PPYQGLSPEESVNVLSAFQEPHLQMPPSLGQMSLPFDQPHPQGLLPCQPQEHAVSSPDPLLCSDVTMVED    701 - 770
SCLSQPVTAFPQGTWIGEDIFPPLLPPTEQDLTKLLLEGQGESGGGSLGAQPLLQPSHYGQSGISMSHMD    771 - 840
LRANPSW                                                                   841 - 847
//

Text Mined References (263)

PMID Year Title
26945968 2016 The anti-proliferative effects of type I IFN involve STAT6-mediated regulation of SP1 and BCL6.
26883114 2016 NAB2-STAT6 Gene Fusion in Meningeal Hemangiopericytoma and Solitary Fibrous Tumor.
26829670 2016 External signals shape the epigenome.
26817999 2016 Case Report: Next generation sequencing identifies a NAB2-STAT6 fusion in Glioblastoma.
26758199 2016 IL-4 orchestrates STAT6-mediated DNA demethylation leading to dendritic cell differentiation.
26686340 2016 The clinicopathological significance of NAB2-STAT6 gene fusions in 52 cases of intrathoracic solitary fibrous tumors.
26617768 2015 Immunohistochemical evaluation of stem cell markers and signal transducer and activator of transcription 6 (STAT6) in solitary fibrous tumors.
26461141 2015 MicroRNA?361?5p suppresses cancer progression by targeting signal transducer and activator of transcription 6 in non?small cell lung cancer.
26246572 2015 Constitutive Activation of Interleukin-13/STAT6 Contributes to Kaposi's Sarcoma-Associated Herpesvirus-Related Primary Effusion Lymphoma Cell Proliferation and Survival.
26226844 2015 NAB2-STAT6 fusion types account for clinicopathological variations in solitary fibrous tumors.
More...