Property Summary

Ligand Count 1
NCBI Gene PubMed Count 699
PubMed Score 2009.03
PubTator Score 1350.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count P-value
breast carcinoma 1638 8.4e-26
juvenile dermatomyositis 1187 5.9e-21
lung carcinoma 2843 2.6e-12
psoriasis 6694 2.9e-10
Breast cancer 3578 1.3e-09
Astrocytoma, Pilocytic 3081 3.5e-08
glioblastoma 5792 6.3e-08
non-small cell lung cancer 2890 1.7e-06
cutaneous lupus erythematosus 1057 1.2e-05
nasopharyngeal carcinoma 1058 1.1e-04
medulloblastoma, large-cell 6241 1.4e-04
primary Sjogren syndrome 735 1.6e-04
lung adenocarcinoma 2716 1.9e-04
atypical teratoid / rhabdoid tumor 5112 2.5e-04
tuberculosis 2010 4.3e-04
active Crohn's disease 922 5.0e-04
group 4 medulloblastoma 1855 8.8e-04
Systemic lupus erythematosus 194 9.4e-04
adult high grade glioma 3801 1.3e-03
intraductal papillary-mucinous carcinoma (IPMC) 2989 1.8e-03
dermatomyositis 966 2.5e-03
intraductal papillary-mucinous neoplasm (IPMN) 3291 3.2e-03
Atopic dermatitis 952 4.0e-03
invasive ductal carcinoma 2951 6.5e-03
active ulcerative colitis 764 6.6e-03
intraductal papillary-mucinous adenoma (IPMA) 2955 7.2e-03
cystic fibrosis 1696 7.5e-03
interstitial cystitis 2312 8.3e-03
lung cancer 4740 8.5e-03
sarcoidosis 370 9.3e-03
pancreatic cancer 2398 9.4e-03
pancreatic carcinoma 562 9.4e-03
Multiple myeloma 1332 1.1e-02
Multiple Sclerosis 540 1.1e-02
ovarian cancer 8520 1.1e-02
osteosarcoma 7950 1.4e-02
Gaucher disease type 1 180 1.7e-02
pancreatic ductal adenocarcinoma liver metastasis 1962 1.8e-02
ductal carcinoma in situ 1745 2.5e-02
ependymoma 4679 2.6e-02
mucosa-associated lymphoid tissue lymphoma 484 2.6e-02
progressive supranuclear palsy 676 3.0e-02
Hydrolethalus syndrome 128 3.4e-02
Alzheimer's disease 658 3.7e-02
head and neck cancer and chronic obstructive pulmonary disease 239 4.0e-02
limb girdle muscular dystrophy 2I 32 4.6e-02
head and neck cancer 271 4.7e-02
esophageal adenocarcinoma 737 5.0e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.2
Kidney cancer 2613 0.0 0.6
Disease Target Count Z-score Confidence
Herpes zoster 68 0.0 5.0

Expression

  Differential Expression (48)

Disease log2 FC p
Multiple Sclerosis 1.400 1.1e-02
psoriasis 1.600 2.9e-10
active Crohn's disease 1.779 5.0e-04
active ulcerative colitis 1.720 6.6e-03
adult high grade glioma 1.100 1.3e-03
Alzheimer's disease -1.300 3.7e-02
Astrocytoma, Pilocytic 1.200 3.5e-08
Atopic dermatitis 1.800 4.0e-03
atypical teratoid / rhabdoid tumor 1.600 2.5e-04
Breast cancer 2.000 1.3e-09
breast carcinoma 1.200 8.4e-26
cutaneous lupus erythematosus 2.000 1.2e-05
cystic fibrosis 1.400 7.5e-03
dermatomyositis 3.200 2.5e-03
ductal carcinoma in situ 1.400 2.5e-02
ependymoma 1.400 2.6e-02
esophageal adenocarcinoma 1.100 5.0e-02
Gaucher disease type 1 -2.600 1.7e-02
glioblastoma 1.200 6.3e-08
group 4 medulloblastoma 1.200 8.8e-04
head and neck cancer 1.500 4.7e-02
head and neck cancer and chronic obstruc... 1.300 4.0e-02
Hydrolethalus syndrome 1.132 3.4e-02
interstitial cystitis 1.700 8.3e-03
intraductal papillary-mucinous adenoma (... 1.600 7.2e-03
intraductal papillary-mucinous carcinoma... 1.600 1.8e-03
intraductal papillary-mucinous neoplasm ... 2.600 3.2e-03
invasive ductal carcinoma 1.154 6.5e-03
juvenile dermatomyositis 3.335 5.9e-21
limb girdle muscular dystrophy 2I 1.119 4.6e-02
lung adenocarcinoma 1.096 1.9e-04
lung cancer -1.100 8.5e-03
lung carcinoma -1.200 2.6e-12
medulloblastoma, large-cell 1.200 1.4e-04
mucosa-associated lymphoid tissue lympho... 1.129 2.6e-02
Multiple myeloma 1.450 1.1e-02
nasopharyngeal carcinoma 1.600 1.1e-04
non-small cell lung cancer 1.057 1.7e-06
osteosarcoma -1.804 1.4e-02
ovarian cancer -1.500 1.1e-02
pancreatic cancer -1.300 9.4e-03
pancreatic carcinoma -1.300 9.4e-03
pancreatic ductal adenocarcinoma liver m... 1.356 1.8e-02
primary Sjogren syndrome 2.800 1.6e-04
progressive supranuclear palsy -1.200 3.0e-02
sarcoidosis 1.700 9.3e-03
Systemic lupus erythematosus 1.200 9.4e-04
tuberculosis 1.500 4.3e-04

Protein-protein Interaction (4)

Gene RIF (610)

AA Sequence

MSQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDVSFATIRFHDLLSQLDDQYSR      1 - 70
FSLENNFLLQHNIRKSKRNLQDNFQEDPIQMSMIIYSCLKEERKILENAQRFNQAQSGNIQSTVMLDKQK     71 - 140
ELDSKVRNVKDKVMCIEHEIKSLEDLQDEYDFKCKTLQNREHETNGVAKSDQKQEQLLLKKMYLMLDNKR    141 - 210
KEVVHKIIELLNVTELTQNALINDELVEWKRRQQSACIGGPPNACLDQLQNWFTIVAESLQQVRQQLKKL    211 - 280
EELEQKYTYEHDPITKNKQVLWDRTFSLFQQLIQSSFVVERQPCMPTHPQRPLVLKTGVQFTVKLRLLVK    281 - 350
LQELNYNLKVKVLFDKDVNERNTVKGFRKFNILGTHTKVMNMEESTNGSLAAEFRHLQLKEQKNAGTRTN    351 - 420
EGPLIVTEELHSLSFETQLCQPGLVIDLETTSLPVVVISNVSQLPSGWASILWYNMLVAEPRNLSFFLTP    421 - 490
PCARWAQLSEVLSWQFSSVTKRGLNVDQLNMLGEKLLGPNASPDGLIPWTRFCKENINDKNFPFWLWIES    491 - 560
ILELIKKHLLPLWNDGCIMGFISKERERALLKDQQPGTFLLRFSESSREGAITFTWVERSQNGGEPDFHA    561 - 630
VEPYTKKELSAVTFPDIIRNYKVMAAENIPENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELDGPKGTG    631 - 700
YIKTELISVSEVHPSRLQTTDNLLPMSPEEFDEVSRIVGSVEFDSMMNTV                        701 - 750
//

Text Mined References (720)

PMID Year Title