Property Summary

NCBI Gene PubMed Count 628
Grant Count 1,112
R01 Count 689
Funding $95,018,093
PubMed Score 1889.26
PubTator Score 1350.87

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (78)

Disease Z-score Confidence
Cancer 2,346 5.355 2.7
Candidiasis 48 4.686 2.3
Hypersensitivity reaction type II diseas... 235  3.975 2.0
Hepatitis 61 3.86 1.9
Hepatitis C 90 3.846 1.9
Multiple Sclerosis 498 3.846 1.9
Arthritis 248 3.665 1.8
Vascular disease 281 3.52 1.8
Lung disease 132 3.435 1.7
Thanatophoric dysplasia 5 3.432 1.7
Encephalitis 54 3.43 1.7
Dermatitis 107 3.243 1.6
Inflammatory bowel disease 142 3.224 1.6
Achondroplasia 20 3.197 1.6
Asthma 349 3.143 1.6
Severe acute respiratory syndrome 26 3.069 1.5
Influenza 142 3.067 1.5
Alzheimer's disease 644
Arthritis, Experimental 39
Atopic dermatitis 944
Breast cancer 3,094
CANDIDIASIS, FAMILIAL, 7 1
Candidiasis, Chronic Mucocutaneous 7
Carcinoma 2,147 1.0
Cytomegalovirus Infections 1
Disease Progression 125
Gaucher disease type 1 171
Hydrolethalus syndrome 128
IMMUNODEFICIENCY 31A 1
IMMUNODEFICIENCY 31B 1
Liver Cirrhosis 101
Liver carcinoma 217
Multiple myeloma 1,327
Mycobacterium Infections 1
Mycobacterium Infections, Nontuberculous 5
Rheumatoid Arthritis 1,160
active Crohn's disease 918
atypical teratoid / rhabdoid tumor 4,369
breast carcinoma 1,614
cutaneous lupus erythematosus 1,056
cystic fibrosis 1,665
dermatomyositis 933
ductal carcinoma in situ 1,745
ependymoma 2,514
esophageal adenocarcinoma 737
glioblastoma 5,572
group 4 medulloblastoma 1,875
head and neck cancer 270
head and neck cancer and chronic obstruc... 237 
hearing impairment 40
interstitial cystitis 2,299
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous carcinoma... 2,988 
intraductal papillary-mucinous neoplasm ... 3,289 
invasive ductal carcinoma 2,950
juvenile dermatomyositis 1,189
limb girdle muscular dystrophy 2I 56
lung adenocarcinoma 2,713
lung cancer 4,466
lung carcinoma 2,844
medulloblastoma, large-cell 6,234
mucosa-associated lymphoid tissue lympho... 480 
nasopharyngeal carcinoma 1,056
non-small cell lung cancer 2,798
osteosarcoma 7,933
ovarian cancer 8,484
pancreatic cancer 2,300
pancreatic carcinoma 567
pancreatic ductal adenocarcinoma liver m... 1,795 
pediatric high grade glioma 2,712
pilocytic astrocytoma 3,086
primary Sjogren syndrome 789
progressive supranuclear palsy 674
psoriasis 6,685
sarcoidosis 358
systemic lupus erythematosus 156
tuberculosis 1,557
ulcerative colitis 2,087

Expression

  Differential Expression (48)

Disease log2 FC p
systemic lupus erythematosus 1.200 0.001
pancreatic cancer 1.600 0.000
Multiple myeloma 1.450 0.011
ependymoma 1.500 0.000
esophageal adenocarcinoma 1.900 0.021
psoriasis -4.100 0.000
cutaneous lupus erythematosus 3.400 0.000
glioblastoma 1.700 0.004
osteosarcoma 1.890 0.004
atypical teratoid / rhabdoid tumor 1.600 0.000
medulloblastoma, large-cell 1.200 0.000
limb girdle muscular dystrophy 2I 1.119 0.046
juvenile dermatomyositis 3.370 0.000
Atopic dermatitis 1.800 0.004
tuberculosis 1.800 0.000
pancreatic ductal adenocarcinoma liver m... 1.356 0.018
non-small cell lung cancer 1.070 0.000
intraductal papillary-mucinous adenoma (... 1.600 0.007
intraductal papillary-mucinous carcinoma... 1.600 0.002
intraductal papillary-mucinous neoplasm ... 2.600 0.003
Hydrolethalus syndrome 1.132 0.034
lung cancer -1.500 0.000
active Crohn's disease 2.410 0.000
ulcerative colitis 2.700 0.000
sarcoidosis 2.000 0.011
Multiple Sclerosis 1.400 0.011
interstitial cystitis 3.200 0.005
cystic fibrosis 1.400 0.007
pediatric high grade glioma 1.500 0.001
group 4 medulloblastoma 1.200 0.001
pilocytic astrocytoma 1.700 0.000
primary Sjogren syndrome 2.900 0.000
pancreatic carcinoma -1.300 0.009
invasive ductal carcinoma 2.400 0.000
nasopharyngeal carcinoma 1.600 0.000
lung adenocarcinoma 1.096 0.000
Breast cancer 2.000 0.000
lung carcinoma -1.200 0.000
breast carcinoma 1.900 0.000
Alzheimer's disease -1.300 0.037
progressive supranuclear palsy -1.200 0.030
mucosa-associated lymphoid tissue lympho... 1.129 0.026
ductal carcinoma in situ 1.400 0.025
ovarian cancer 2.300 0.000
Gaucher disease type 1 -2.600 0.017
dermatomyositis 3.200 0.003
head and neck cancer 1.500 0.047
head and neck cancer and chronic obstruc... 1.300 0.040

Synonym

Accession P42224 A8K989 B2RCA0 D2KFR8 D3DPI7 Q53S88 Q53XW4 Q68D00 Q9UDL5
Symbols CANDF7
IMD31A
IMD31B
IMD31C
ISGF-3
STAT91

Gene

PANTHER Protein Class (1)

PDB

1BF5   1YVL   2KA6   3WWT  

MLP Assay (18)

AID Type Active / Inconclusive / Inactive Description
920 screening 695 / 0 / 195317 Primary cell-based high throughput screening assay to measure STAT1 inhibition
932 screening 5134 / 0 / 190878 Primary cell-based high throughput screening assay to measure STAT1 activation
1262 screening 1207 / 0 / 39 Confirmation cell-based high throughput screening assay to measure STAT1 activation
1263 screening 109 / 0 / 90 Confirmation cell-based high throughput screening assay to measure STAT1 inhibition
1303 screening 57 / 0 / 142 Counterscreen assay for STAT1 inhibitors: Cell-based high throughput assay to measure NF-kappaB inhibition
1306 screening 538 / 0 / 708 Counterscreen assay for STAT1 activators: Cell-based high throughput assay to measure NF-kappaB activation
1317 screening 328 / 0 / 887 Counterscreen assay for STAT3 inhibitors: Cell-based high throughput assay to measure STAT1 inhibition
1318 screening 156 / 0 / 1041 Counterscreen assay for STAT3 activators: Cell-based high throughput assay to measure STAT1 activation
1396 confirmatory 14 / 0 / 39 Dose response cell-based assay to measure STAT1 inhibition
1397 confirmatory 74 / 0 / 33 Dose response cell-based assay to measure STAT1 activation
More...

Gene RIF (547)

PMID Text
26966684 Stable isotope labeling by amino acids in cell culture (SILAC) was applied to analyze the STAT1 interactome after streptavidin pull-down of biotagged STAT1 from human embryonic kidney 293T cells with and without activation. Starting from more than 2,000 captured proteins 30 potential STAT1 interaction partners were extracted
26928402 Results showed that CD146 promoted metastasis of hepatocellular carcinoma (HCC) cells and predicted poor prognosis of HCC patients. CD146 induced epithelial mesenchymal transition through probably IL-8 up-regulation and STAT1 down-regulation.
26795953 findings suggest that PRMT1 is a central regulator of tissue remodeling and that the signaling sequence controlling its expression in primary human lung fibroblast is PDGF-ERK-STAT1.
26747737 STAT1 phosphorylation is impaired in juvenile idiopathic arthritis monocytes, consistent with skewing of systemic JIA monocytes away from an M1 phenotype.
26719274 Parainfluenza virus 3 therefore interferes with the phosphorylation of Stat1 downstream of the type III interferon receptor.
26678048 Our results suggest that NFkappaB, STAT1 and STAT3 underlie transcriptional changes and chronic inflammation in the aging human kidney
26676844 Our results showed that FAM172A could suppress proliferation of colon cancer cells, and STAT1 could bind to the minimum promoter region of FAM172A and upregulated the expression of FAM172A
26676749 a novel role for JAK2/STAT1 in EGFR-mediated immune evasion, and therapies targeting this signaling axis may be beneficial to block PD-L1 upregulation found in a large subset of head and neck cancer tumors.
26635038 STAT1 activation in association with JAK2 exon 12 mutations.
26604104 mutations are frequently observed in patients suffering from Chronic Mucocutaneous Candidiasis
More...

AA Sequence

MSQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDVSFATIRFHDLLSQLDDQYSR      1 - 70
FSLENNFLLQHNIRKSKRNLQDNFQEDPIQMSMIIYSCLKEERKILENAQRFNQAQSGNIQSTVMLDKQK     71 - 140
ELDSKVRNVKDKVMCIEHEIKSLEDLQDEYDFKCKTLQNREHETNGVAKSDQKQEQLLLKKMYLMLDNKR    141 - 210
KEVVHKIIELLNVTELTQNALINDELVEWKRRQQSACIGGPPNACLDQLQNWFTIVAESLQQVRQQLKKL    211 - 280
EELEQKYTYEHDPITKNKQVLWDRTFSLFQQLIQSSFVVERQPCMPTHPQRPLVLKTGVQFTVKLRLLVK    281 - 350
LQELNYNLKVKVLFDKDVNERNTVKGFRKFNILGTHTKVMNMEESTNGSLAAEFRHLQLKEQKNAGTRTN    351 - 420
EGPLIVTEELHSLSFETQLCQPGLVIDLETTSLPVVVISNVSQLPSGWASILWYNMLVAEPRNLSFFLTP    421 - 490
PCARWAQLSEVLSWQFSSVTKRGLNVDQLNMLGEKLLGPNASPDGLIPWTRFCKENINDKNFPFWLWIES    491 - 560
ILELIKKHLLPLWNDGCIMGFISKERERALLKDQQPGTFLLRFSESSREGAITFTWVERSQNGGEPDFHA    561 - 630
VEPYTKKELSAVTFPDIIRNYKVMAAENIPENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELDGPKGTG    631 - 700
YIKTELISVSEVHPSRLQTTDNLLPMSPEEFDEVSRIVGSVEFDSMMNTV                        701 - 750
//

Text Mined References (648)

PMID Year Title
26966684 2016 PIPINO: A Software Package to Facilitate the Identification of Protein-Protein Interactions from Affinity Purification Mass Spectrometry Data.
26928402 2016 CD146 promotes metastasis and predicts poor prognosis of hepatocellular carcinoma.
26889034 2016 VP8, the Major Tegument Protein of Bovine Herpesvirus 1, Interacts with Cellular STAT1 and Inhibits Interferon Beta Signaling.
26795953 2016 PDGF-BB induces PRMT1 expression through ERK1/2 dependent STAT1 activation and regulates remodeling in primary human lung fibroblasts.
26747737 2016 Altered signaling in systemic juvenile idiopathic arthritis monocytes.
26719274 2015 Parainfluenza Virus 3 Blocks Antiviral Mediators Downstream of the Interferon Lambda Receptor by Modulating Stat1 Phosphorylation.
26678048 2015 The Inflammatory Transcription Factors NF?B, STAT1 and STAT3 Drive Age-Associated Transcriptional Changes in the Human Kidney.
26676844 2016 FAM172A modulates apoptosis and proliferation of colon cancer cells via STAT1 binding to its promoter.
26676749 2016 Identification of the Cell-Intrinsic and -Extrinsic Pathways Downstream of EGFR and IFN? That Induce PD-L1 Expression in Head and Neck Cancer.
26635038 2016 STAT1 activation in association with JAK2 exon 12 mutations.
More...