Property Summary

NCBI Gene PubMed Count 56
PubMed Score 241.41
PubTator Score 109.07

Knowledge Summary


No data available



Accession P42167 A2T926 Q14861
Symbols TP


Gene RIF (23)

26443848 LAP2alpha can regulate extracellular matrix components independently of lamins A/C, which may help explain the proliferation-promoting function of LAP2alpha in cells expressing progerin.
26312502 The authors find that LAP2alpha (lamina-associated polypeptide-alpha) interacts with lamin A, while its interaction with progerin is significantly reduced.
26092935 The findings unveil a unique mechanism where the nuclear periphery proteins lamin-A/C, LAP2alpha and BAF1 are assembled into a protein complex during mitosis in order to regulate assembly and positioning of the mitotic spindle.
25837847 Results suggest that TMPObeta and -gamma isoforms could provide a potential reliable diagnostic marker for breast cancer.
25631074 Cellular biotinylated lamina-associated polypeptide 2, beta/gamma (LAP2) protein is incorporated into HIV-1 Gag virus-like particles
24375709 Results highlight the interactions at the nuclear envelope where mutations in the EMD and TMPO gene in combination with mutations in SUN1 have an impact on several components of the network.
23673662 Data indicate that cells lacking either high mobility group protein N5 (HMGN5) and lamina-associated polypeptide 2alpha (LAP2alpha) showed that loss of either protein affects the genome-wide distribution of the remaining partner.
21990273 this study provides evidence for elevated LAP2alpha expression in cervical cancer and suggests that E2F and p53 activities associate with the positive and negative regulation of LAP2alpha expression, respectively
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

VVVAVFLFLVYQAMETNQVNPFSNFLHVDPRKSN                                        421 - 454

Text Mined References (72)

PMID Year Title
26443848 2015 Proliferation of progeria cells is enhanced by lamina-associated polypeptide 2? (LAP2?) through expression of extracellular matrix proteins.
26312502 2015 Progerin reduces LAP2?-telomere association in Hutchinson-Gilford progeria.
26092935 2015 The lamin-A/C-LAP2?-BAF1 protein complex regulates mitotic spindle assembly and positioning.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25837847 2015 Thymopoietin Beta and Gamma Isoforms as a Potential Diagnostic Molecular Marker for Breast Cancer: Preliminary Data.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24375709 2014 Contribution of SUN1 mutations to the pathomechanism in muscular dystrophies.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23673662 2013 High mobility group protein N5 (HMGN5) and lamina-associated polypeptide 2? (LAP2?) interact and reciprocally affect their genome-wide chromatin organization.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.