Property Summary

NCBI Gene PubMed Count 56
PubMed Score 241.41
PubTator Score 109.07

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (7)

Disease Target Count P-value
non-small cell lung cancer 2798 2.51900919768199E-26
juvenile dermatomyositis 1189 3.53542919286912E-11
Breast cancer 3099 7.07170573231246E-10
medulloblastoma, large-cell 6234 2.35271309168124E-8
group 4 medulloblastoma 1875 3.98276245132794E-8
adrenocortical carcinoma 1427 9.66298557136408E-8
primitive neuroectodermal tumor 3031 1.17749298092911E-6
malignant mesothelioma 3163 2.20065179430604E-6
atypical teratoid / rhabdoid tumor 4369 2.34290369097805E-6
nasopharyngeal carcinoma 1056 5.45178125911378E-6
osteosarcoma 7933 2.88723395697733E-5
colon cancer 1475 4.36356061774355E-5
lung cancer 4473 9.13359331371916E-5
lung adenocarcinoma 2714 2.11355350629158E-4
ductal carcinoma in situ 1745 0.0015140277514801
invasive ductal carcinoma 2950 0.00175399733622178
ependymoma 2514 0.00202055846939123
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00274194318467932
pediatric high grade glioma 2712 0.00357498794678701
primary Sjogren syndrome 789 0.00504395789700436
glioblastoma 5572 0.00665159719385155
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0142672707892702
Waldenstrons macroglobulinemia 765 0.0166828799993546
subependymal giant cell astrocytoma 2287 0.0308764038793341
Hydrolethalus syndrome 128 0.0378482079012392
sarcoidosis 368 0.0451841295259316
Disease Target Count Z-score Confidence
Rheumatoid Arthritis 1171 0.0 1.0
Disease Target Count Z-score Confidence
Dilated cardiomyopathy 51 0.0 5.0
Disease Target Count Z-score Confidence
Cardiomyopathy 110 0.0 4.0

Expression

Synonym

Accession P42167 A2T926 Q14861
Symbols TP
LAP2
CMD1T
LEMD4
PRO0868

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG
Opossum OMA EggNOG
Anole lizard OMA EggNOG
Xenopus OMA EggNOG Inparanoid

Gene RIF (23)

PMID Text
26443848 LAP2alpha can regulate extracellular matrix components independently of lamins A/C, which may help explain the proliferation-promoting function of LAP2alpha in cells expressing progerin.
26312502 The authors find that LAP2alpha (lamina-associated polypeptide-alpha) interacts with lamin A, while its interaction with progerin is significantly reduced.
26092935 The findings unveil a unique mechanism where the nuclear periphery proteins lamin-A/C, LAP2alpha and BAF1 are assembled into a protein complex during mitosis in order to regulate assembly and positioning of the mitotic spindle.
25837847 Results suggest that TMPObeta and -gamma isoforms could provide a potential reliable diagnostic marker for breast cancer.
25631074 Cellular biotinylated lamina-associated polypeptide 2, beta/gamma (LAP2) protein is incorporated into HIV-1 Gag virus-like particles
24375709 Results highlight the interactions at the nuclear envelope where mutations in the EMD and TMPO gene in combination with mutations in SUN1 have an impact on several components of the network.
23673662 Data indicate that cells lacking either high mobility group protein N5 (HMGN5) and lamina-associated polypeptide 2alpha (LAP2alpha) showed that loss of either protein affects the genome-wide distribution of the remaining partner.
21990273 this study provides evidence for elevated LAP2alpha expression in cervical cancer and suggests that E2F and p53 activities associate with the positive and negative regulation of LAP2alpha expression, respectively
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MPEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNRPPLPAGTNSKGPPDFSSDEE      1 - 70
REPTPVLGSGAAAAGRSRAAVGRKATKKTDKPRQEDKDDLDVTELTNEDLLDQLVKYGVNPGPIVGTTRK     71 - 140
LYEKKLLKLREQGTESRSSTPLPTISSSAENTRQNGSNDSDRYSDNEEDSKIELKLEKREPLKGRAKTPV    141 - 210
TLKQRRVEHNQSYSQAGITETEWTSGSSKGGPLQALTRESTRGSRRTPRKRVETSEHFRIDGPVISESTP    211 - 280
IAETIMASSNESLVVNRVTGNFKHASPILPITEFSDIPRRAPKKPLTRAEVGEKTEERRVERDILKEMFP    281 - 350
YEASTPTGISASCRRPIKGAAGRPLELSDFRMEESFSSKYVPKYVPLADVKSEKTKKGRSIPVWIKILLF    351 - 420
VVVAVFLFLVYQAMETNQVNPFSNFLHVDPRKSN                                        421 - 454
//

Text Mined References (72)

PMID Year Title
26443848 2015 Proliferation of progeria cells is enhanced by lamina-associated polypeptide 2? (LAP2?) through expression of extracellular matrix proteins.
26312502 2015 Progerin reduces LAP2?-telomere association in Hutchinson-Gilford progeria.
26092935 2015 The lamin-A/C-LAP2?-BAF1 protein complex regulates mitotic spindle assembly and positioning.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25837847 2015 Thymopoietin Beta and Gamma Isoforms as a Potential Diagnostic Molecular Marker for Breast Cancer: Preliminary Data.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
24375709 2014 Contribution of SUN1 mutations to the pathomechanism in muscular dystrophies.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23673662 2013 High mobility group protein N5 (HMGN5) and lamina-associated polypeptide 2? (LAP2?) interact and reciprocally affect their genome-wide chromatin organization.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...