Property Summary

NCBI Gene PubMed Count 57
PubMed Score 246.04
PubTator Score 109.07

Knowledge Summary

Patent

No data available

TINX Plot

Gene RIF (24)

AA Sequence

MPEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNRPPLPAGTNSKGPPDFSSDEE      1 - 70
REPTPVLGSGAAAAGRSRAAVGRKATKKTDKPRQEDKDDLDVTELTNEDLLDQLVKYGVNPGPIVGTTRK     71 - 140
LYEKKLLKLREQGTESRSSTPLPTISSSAENTRQNGSNDSDRYSDNEEDSKIELKLEKREPLKGRAKTPV    141 - 210
TLKQRRVEHNQSYSQAGITETEWTSGSSKGGPLQALTRESTRGSRRTPRKRVETSEHFRIDGPVISESTP    211 - 280
IAETIMASSNESLVVNRVTGNFKHASPILPITEFSDIPRRAPKKPLTRAEVGEKTEERRVERDILKEMFP    281 - 350
YEASTPTGISASCRRPIKGAAGRPLELSDFRMEESFSSKYVPKYVPLADVKSEKTKKGRSIPVWIKILLF    351 - 420
VVVAVFLFLVYQAMETNQVNPFSNFLHVDPRKSN                                        421 - 454
//

Text Mined References (74)

PMID Year Title