Property Summary

NCBI Gene PubMed Count 40
PubMed Score 57.19
PubTator Score 58.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Melanoma 711 3.51 1.8
Carcinoma, Basal Cell 28 0.0 0.0
Skin Neoplasms 69 0.0 0.0
Disease Target Count
Basal cell carcinoma 54
Disease Target Count P-value
psoriasis 6694 3.0e-44
ovarian cancer 8520 1.5e-11
Disease Target Count Z-score Confidence
Obesity 678 3.181 1.6
Vitiligo 73 3.016 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
ovarian cancer 1.100 1.5e-11
psoriasis -1.700 3.0e-44

Synonym

Accession P42127 Q3SXL2 ASP
Symbols ASP
AGSW
AGTI
AGTIL
SHEP9

Gene

PANTHER Protein Class (1)

PDB

2IQW   1Y7J   1Y7K   2KZA   2L1J  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG Inparanoid

Gene RIF (35)

AA Sequence

MDVTRLLLATLLVFLCFFTANSHLPPEEKLRDDRSLRSNSSVNLLDVPSVSIVALNKKSKQIGRKAAEKK      1 - 70
RSSKKEASMKKVVRPRTPLSAPCVATRNSCKPPAPACCDPCASCQCRFFRSACSCRVLSLNC             71 - 132
//

Text Mined References (41)

PMID Year Title