Property Summary

NCBI Gene PubMed Count 10
PubMed Score 459.06
PubTator Score 18.72

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 1.210 6.0e-04
ovarian cancer 1.300 7.5e-04
psoriasis -1.200 5.0e-09

Gene RIF (3)

AA Sequence

MALVASVRVPARVLLRAGARLPGAALGRTERAAGGGDGARRFGSQRVLVEPDAGAGVAVMKFKNPPVNSL      1 - 70
SLEFLTELVISLEKLENDKSFRGVILTSDRPGVFSAGLDLTEMCGRSPAHYAGYWKAVQELWLRLYQSNL     71 - 140
VLVSAINGACPAGGCLVALTCDYRILADNPRYCIGLNETQLGIIAPFWLKDTLENTIGHRAAERALQLGL    141 - 210
LFPPAEALQVGIVDQVVPEEQVQSTALSAIAQWMAIPDHARQLTKAMMRKATASRLVTQRDADVQNFVSF    211 - 280
ISKDSIQKSLQMYLERLKEEKG                                                    281 - 302
//

Text Mined References (15)

PMID Year Title