Property Summary

NCBI Gene PubMed Count 181
Grant Count 662
R01 Count 409
Funding $49,122,333.38
PubMed Score 2733.84
PubTator Score 1112.42

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P42081 A0N0P0 B7Z2F3 B7Z702 E7ETN5 E9PC27 Q13655 Q6FHB1 Q6GTS4 Q7M4L5
Symbols B70
B7-2
B7.2
LAB72
CD28LG2

Gene

PDB

1I85   1NCN  

Gene RIF (181)

PMID Text
26901523 The SNP CD40 -1C>T was associated with the IgG response against PvDBP, whereas IgG antibody titers against PvMSP-119 were influenced by the polymorphism CD86 +1057G>A.
26416278 Data show that induction of CD86 antigen expression on monocytes by human beta Defensin-3 (hBD-3) is suppressed by P2X7 purinoceptor (P2X7R) antagonist.
25912130 CD86 polymorphisms are associated with susceptibility to pneumonia-induced sepsis and may affect gene expression in monocytes.
25896473 Results support a CTLA4-Ig/CD86 interaction on gammaIFN and IL-17 activated endothelial cells that modulates the expression of VEGFR-2 and ICAM1.
25892855 analysis of the expression of TLR-9, CD86, and CD95 in circulating B cells of patients with chronic viral hepatitis B or C before and after antiviral therapy
25482673 TLR2, TLR4 and CD86 gene polymorphisms are associated with Recurrent aphthous stomatitis.
25369324 CD86 polymorphisms (rs1129055) may have protective effects on cancer risk in Asians and that CD86 polymorphisms (rs17281995) is likely to contribute to risk of cancer, particularly colorectal cancer in Caucasians.
25248333 The immobilization of HIV-1 p24 antigen on the micelles upregulates the expression of cell surface markers CD80 and CD86 in human dendritic cells
25129060 Polymorphisms in CD86 gene have diverse effects on the pathogenesis of pneumonia-induced sepsis.
24981893 Meningococcal capsular polysaccharide-loaded vaccine nanoparticles induce expression of CD86.
More...

AA Sequence

MDPQCTMGLSNILFVMAFLLSGAAPLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYL      1 - 70
GKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPE     71 - 140
IVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGVMQKSQDNVTELYDVSISLSVSFPDV    141 - 210
TSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIPWITAVLPTVIICVMVFCLILWKWKKKKRPRNSY    211 - 280
KCGTNTMEREESEQTKKREKIHIPERSDEAQRVFKSSKTSSCDKSDTCF                         281 - 329
//

Text Mined References (184)

PMID Year Title
26901523 2016 Polymorphisms in B Cell Co-Stimulatory Genes Are Associated with IgG Antibody Responses against Blood-Stage Proteins of Plasmodium vivax.
26416278 2015 Human ? Defensin-3 Increases CD86 Expression on Monocytes by Activating the ATP-Gated Channel P2X7.
25912130 2015 Functional polymorphisms in CD86 gene are associated with susceptibility to pneumonia-induced sepsis.
25896473 CTLA4-Ig/CD86 interactions in cultured human endothelial cells: effects on VEGFR-2 and ICAM1 expression.
25892855 2015 The expression of TLR-9, CD86, and CD95 phenotypes in circulating B cells of patients with chronic viral hepatitis B or C before and after antiviral therapy.
25482673 2015 TLR2, TLR4 and CD86 gene polymorphisms in recurrent aphthous stomatitis.
25369324 2014 Distinct role of CD86 polymorphisms (rs1129055, rs17281995) in risk of cancer: evidence from a meta-analysis.
25279986 2014 Genome-wide association study identifies five susceptibility loci for follicular lymphoma outside the HLA region.
25261932 2014 Genome-wide association study identifies multiple susceptibility loci for diffuse large B cell lymphoma.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
More...