Property Summary

Ligand Count 2
NCBI Gene PubMed Count 188
PubMed Score 2838.91
PubTator Score 1112.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count
Contact Dermatitis 81
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Multiple Sclerosis 540 4.295 2.1

Expression

  Differential Expression (19)

Disease log2 FC p
adult high grade glioma 1.100 5.1e-03
Astrocytoma, Pilocytic 1.300 1.6e-07
cutaneous lupus erythematosus 2.300 3.8e-03
cystic fibrosis 1.500 2.5e-03
gastric cancer -1.100 6.2e-04
glioblastoma 1.100 8.6e-03
group 3 medulloblastoma -1.300 9.9e-03
head and neck cancer and chronic obstruc... 1.500 1.2e-03
inflammatory breast cancer 3.000 3.9e-02
interstitial cystitis 1.200 3.8e-03
intraductal papillary-mucinous carcinoma... -1.100 6.3e-03
invasive ductal carcinoma 1.908 1.1e-03
lung cancer -1.300 9.1e-04
lung carcinoma -2.400 3.6e-17
malignant mesothelioma -1.100 1.1e-04
non-small cell lung cancer -1.062 1.3e-07
primary Sjogren syndrome 1.100 1.2e-02
subependymal giant cell astrocytoma 1.050 4.4e-02
ulcerative colitis 2.500 1.2e-07

Protein-protein Interaction (2)

Gene RIF (181)

AA Sequence

MDPQCTMGLSNILFVMAFLLSGAAPLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYL      1 - 70
GKEKFDSVHSKYMGRTSFDSDSWTLRLHNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPE     71 - 140
IVPISNITENVYINLTCSSIHGYPEPKKMSVLLRTKNSTIEYDGVMQKSQDNVTELYDVSISLSVSFPDV    141 - 210
TSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDHIPWITAVLPTVIICVMVFCLILWKWKKKKRPRNSY    211 - 280
KCGTNTMEREESEQTKKREKIHIPERSDEAQRVFKSSKTSSCDKSDTCF                         281 - 329
//

Text Mined References (191)

PMID Year Title