Property Summary

NCBI Gene PubMed Count 14
PubMed Score 4.30
PubTator Score 19.88

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (4)

Disease log2 FC p
diabetes mellitus -1.100 2.2e-03
ovarian cancer 1.300 6.6e-06
Pick disease -1.100 1.7e-05
subependymal giant cell astrocytoma -1.057 1.4e-02

 GO Function (1)

Gene RIF (2)

AA Sequence

MESYDIIANQPVVIDNGSGVIKAGFAGDQIPKYCFPNYVGRPKHMRVMAGALEGDLFIGPKAEEHRGLLT      1 - 70
IRYPMEHGVVRDWNDMERIWQYVYSKDQLQTFSEEHPVLLTEAPLNPSKNREKAAEVFFETFNVPALFIS     71 - 140
MQAVLSLYATGRTTGVVLDSGDGVTHAVPIYEGFAMPHSIMRVDIAGRDVSRYLRLLLRKEGVDFHTSAE    141 - 210
FEVVRTIKERACYLSINPQKDEALETEKVQYTLPDGSTLDVGPARFRAPELLFQPDLVGDESEGLHEVVA    211 - 280
FAIHKSDMDLRRTLFANIVLSGGSTLFKGFGDRLLSEVKKLAPKDIKIKISAPQERLYSTWIGGSILASL    281 - 350
DTFKKMWVSKKEYEEDGSRAIHRKTF                                                351 - 376
//

Text Mined References (18)

PMID Year Title