Property Summary

Ligand Count 81
NCBI Gene PubMed Count 94
PubMed Score 445.30
PubTator Score 208.70

Knowledge Summary

Patent (48,013)

Gene RIF (84)

AA Sequence

MNASCCLPSVQPTLPNGSEHLQAPFFSNQSSSAFCEQVFIKPEVFLSLGIVSLLENILVILAVVRNGNLH      1 - 70
SPMYFFLCSLAVADMLVSVSNALETIMIAIVHSDYLTFEDQFIQHMDNIFDSMICISLVASICNLLAIAV     71 - 140
DRYVTIFYALRYHSIMTVRKALTLIVAIWVCCGVCGVVFIVYSESKMVIVCLITMFFAMMLLMGTLYVHM    141 - 210
FLFARLHVKRIAALPPADGVAPQQHSCMKGAVTITILLGVFIFCWAPFFLHLVLIITCPTNPYCICYTAH    211 - 280
FNTYLVLIMCNSVIDPLIYAFRSLELRNTFREILCGCNGMNLG                               281 - 323
//

Text Mined References (94)

PMID Year Title