Property Summary

NCBI Gene PubMed Count 90
Grant Count 211
R01 Count 141
Funding $27,613,296.26
PubMed Score 449.99
PubTator Score 208.70

Knowledge Summary

Patent (48,013)

Synonym

Accession P41968 Q4KN27 Q9H517 MC3-R
Symbols MC3
OB20
OQTL
BMIQ9
MC3-R

Gene

PANTHER Protein Class (2)

  TechDev Info (1)

Gene RIF (80)

PMID Text
26818770 Replacing murine Mc3r with and double-mutant (C17A+G241A) human MC3R showed greater weight and fat mass, increased energy intake and feeding efficiency.
26782456 There is no evidence of any association between MC3R variations and obesity.
26223677 melanocortin receptors MC2R, MC3R and MC5R are most abundantly expressed in glandular epithelium of the endometrium
26220347 the DPLIY motif and helix 8 was important for MC3R activation and signal transduction. The data led to a better understanding of the structure-function relationship of MC3R.
25798062 novel data about the structure-function relationship of MC3R, identifying residues important for receptor function; some studied mutations exhibited biased signaling, preferentially activating one intracellular signaling pathway.
25450386 3' RACE experiments using MC3R transcript indicated the 3' UTR terminates approximately 115-160 bases after the translational stop codon.
25228159 The cytoplasmic end of transmembrane domain 3 and the intracellular loop 2 were critical for MC3R function.
25064630 MC3R polymorphism is marginally associated in the development of pulmonary tuberculosis in Korean population.
25051171 MC3R is a 2-exon gene that requires a 5' UTR for translation, localization, and potential interaction with MRAP2
24821406 propose three potential human candidate genes for voluntary physical exercise levels (MC3R, CYP24A1, and GRM8).
More...

AA Sequence

MNASCCLPSVQPTLPNGSEHLQAPFFSNQSSSAFCEQVFIKPEVFLSLGIVSLLENILVILAVVRNGNLH      1 - 70
SPMYFFLCSLAVADMLVSVSNALETIMIAIVHSDYLTFEDQFIQHMDNIFDSMICISLVASICNLLAIAV     71 - 140
DRYVTIFYALRYHSIMTVRKALTLIVAIWVCCGVCGVVFIVYSESKMVIVCLITMFFAMMLLMGTLYVHM    141 - 210
FLFARLHVKRIAALPPADGVAPQQHSCMKGAVTITILLGVFIFCWAPFFLHLVLIITCPTNPYCICYTAH    211 - 280
FNTYLVLIMCNSVIDPLIYAFRSLELRNTFREILCGCNGMNLG                               281 - 323
//

Text Mined References (90)

PMID Year Title
26818770 2016 A mouse model for a partially inactive obesity-associated human MC3R variant.
26782456 2015 Genetic variant screening of MC3R and MC4R genes in early-onset obese children and their relatives among a Thai population: family-based study.
26223677 2015 Expression of melanocortin receptors in human endometrium.
26220347 2015 Functions of DPLIY motif and helix 8 of human melanocortin-3 receptor.
25798062 2015 Biased signaling in naturally occurring mutations in human melanocortin-3 receptor gene.
25450386 2014 Evaluation of hypothalamic murine and human melanocortin 3 receptor transcript structure.
25228159 2014 Functions of the DRY motif and intracellular loop 2 of human melanocortin 3 receptor.
25064630 2014 Association analysis of melanocortin 3 receptor polymorphisms with the risk of pulmonary tuberculosis.
25051171 2014 Melanocortin 3 receptor has a 5' exon that directs translation of apically localized protein from the second in-frame ATG.
24821406 2015 A candidate syntenic genetic locus is associated with voluntary exercise levels in mice and humans.
More...