Property Summary

NCBI Gene PubMed Count 138
Grant Count 43
R01 Count 24
Funding $2,417,392.91
PubMed Score 51.76
PubTator Score 85.57

Knowledge Summary

Patent (5,563)

Expression

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
588725 other 0 / 0 / 1 Late stage counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): Radioactivity-based biochemical assay to identify modulators of a panel of 48 kinases
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (120)

PMID Text
26792725 effects. Further studies indicated that PRKCI knockdown-mediated autophagy was associated with the inactivation of phosphatidylinositol 3-kinase alpha/AKT-mammalian target of rapamycin (PIK3CA/AKT-MTOR) signaling.
26475383 the results revealed that PRKCI rs546950 variant decreased the risk of prostate cancer in an Iranian population
25694446 PKCiota binds to Rab14 and that PKCiota requires Rab14 for its correct distribution in cells. As with Rab14, PKCiota protects claudin-2 from lysosomal degradation and, in consequence, modulates epithelial barrier.
25501807 the knockdown of aPKC increases and extends TGFbeta-induced p38 MAPK activation, which sensitizes NSCLC cells to undergo apoptosis.
25118327 Targeting aPKC disables oncogenic signaling by both the EGFR and the proinflammatory cytokine TNFalpha in glioblastoma.
24887021 These data indicates the existence of a SDF-1alpha induced DGKalpha - atypical PKC - beta1 integrin signaling pathway, which is essential for matrix invasion of carcinoma cells.
24876225 Constitutive expression of BAG-1M decreased levels of phosphorylated aPKC.
24786829 The results indicate that induction and activation of PKClambda promote TNBC growth, invasion and metastasis.
24753582 Report up-regulation of MT1-MMP and atypical protein kinase C in hormone receptor-negative breast tumors in association with a higher risk of metastasis. Silencing of aPKC impaired delivery of MT1-MMP from storage compartments and inhibited invasion.
24651432 Suggest that aPKCiota could be an important bio-marker of tumor epithelial-mesenchymal transition, and used as an indicator of invasion and malignancy in hepatocellular carcinoma.
More...

AA Sequence

MPTQRDSSTMSHTVAGGGSGDHSHQVRVKAYYRGDIMITHFEPSISFEGLCNEVRDMCSFDNEQLFTMKW      1 - 70
IDEEGDPCTVSSQLELEEAFRLYELNKDSELLIHVFPCVPERPGMPCPGEDKSIYRRGARRWRKLYCANG     71 - 140
HTFQAKRFNRRAHCAICTDRIWGLGRQGYKCINCKLLVHKKCHKLVTIECGRHSLPQEPVMPMDQSSMHS    141 - 210
DHAQTVIPYNPSSHESLDQVGEEKEAMNTRESGKASSSLGLQDFDLLRVIGRGSYAKVLLVRLKKTDRIY    211 - 280
AMKVVKKELVNDDEDIDWVQTEKHVFEQASNHPFLVGLHSCFQTESRLFFVIEYVNGGDLMFHMQRQRKL    281 - 350
PEEHARFYSAEISLALNYLHERGIIYRDLKLDNVLLDSEGHIKLTDYGMCKEGLRPGDTTSTFCGTPNYI    351 - 420
APEILRGEDYGFSVDWWALGVLMFEMMAGRSPFDIVGSSDNPDQNTEDYLFQVILEKQIRIPRSLSVKAA    421 - 490
SVLKSFLNKDPKERLGCHPQTGFADIQGHPFFRNVDWDMMEQKQVVPPFKPNISGEFGLDNFDSQFTNEP    491 - 560
VQLTPDDDDIVRKIDQSEFEGFEYINPLLMSAEECV                                      561 - 596
//

Text Mined References (154)

PMID Year Title
26977885 2016 Protein Kinase C? Drives a NOTCH3-dependent Stem-like Phenotype in Mutant KRAS Lung Adenocarcinoma.
26792725 2016 PRKCI negatively regulates autophagy via PIK3CA/AKT-MTOR signaling.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26475383 2015 Association of polymorphisms in PRKCI gene and risk of prostate cancer in a sample of Iranian Population.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25694446 2015 PKC? interacts with Rab14 and modulates epithelial barrier function through regulation of claudin-2 levels.
25501807 2015 aPKC alters the TGF? response in NSCLC cells through both Smad-dependent and Smad-independent pathways.
25118327 2014 Targeting aPKC disables oncogenic signaling by both the EGFR and the proinflammatory cytokine TNF? in glioblastoma.
24887021 2014 The diacylglycerol kinase ?/atypical PKC/?1 integrin pathway in SDF-1? mammary carcinoma invasiveness.
24876225 2014 The BAG-1 isoform BAG-1M regulates keratin-associated Hsp70 chaperoning of aPKC in intestinal cells during activation of inflammatory signaling.
More...