Property Summary

NCBI Gene PubMed Count 26
PubMed Score 76.04
PubTator Score 27.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count P-value
breast carcinoma 1614 8.96698223729568E-18
non-small cell lung cancer 2798 2.76031718578234E-11
medulloblastoma, large-cell 6234 6.64962830229381E-8
psoriasis 6685 1.7713256465284E-7
atypical teratoid / rhabdoid tumor 4369 4.3444724912741E-7
Breast cancer 3099 5.54884576282788E-7
lung cancer 4473 5.83352219470186E-7
ulcerative colitis 2087 8.1661895034897E-7
posterior fossa group A ependymoma 1511 2.03130234047202E-6
intraductal papillary-mucinous adenoma (IPMA) 2956 3.36148067082777E-6
ovarian cancer 8492 2.86103967132385E-5
intraductal papillary-mucinous carcinoma (IPMC) 2988 3.94213870079444E-5
primary Sjogren syndrome 789 1.1661651179006E-4
lung adenocarcinoma 2714 2.25086237293065E-4
invasive ductal carcinoma 2950 4.32994282245693E-4
group 3 medulloblastoma 2254 4.9818558531083E-4
colon cancer 1475 5.5724040980624E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 6.61737817538377E-4
pancreatic cancer 2300 7.19123345425657E-4
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0014912067452967
pediatric high grade glioma 2712 0.00153641031152151
ductal carcinoma in situ 1745 0.00178352879336543
glioblastoma 5572 0.00537937049076336
Pick disease 1893 0.00779504084814678
subependymal giant cell astrocytoma 2287 0.016559825053801
active Crohn's disease 918 0.0245687305358918
Disease Target Count Z-score Confidence
Anorexia nervosa 59 0.0 1.0
Disease Target Count Z-score Confidence
Intellectual disability 573 4.326 2.2

Expression

Synonym

Accession P41732 B2R5W7 D3DWB1 Q8WVG5 Q9UEY9 Tspan-7
Symbols A15
MXS1
CD231
MRX58
CCG-B7
TM4SF2
TALLA-1
TM4SF2b
DXS1692E

Gene

  Ortholog (13)

Species Source
Chimp OMA EggNOG Inparanoid
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG
Chicken OMA EggNOG
Anole lizard OMA EggNOG
Xenopus OMA EggNOG
Zebrafish OMA EggNOG

Gene RIF (15)

PMID Text
25637218 Elevated TSPAN7 may be associated with better outcomes for multiple myeloma patients.
25275127 Both HIV-1 Nef and Vpu downregulate the cell surface expression of tetraspanin 7 (TSPAN7, CD231)
23284715 Both HIV-1 Nef and Vpu downregulate the cell surface expression of tetraspanin 7 (TSPAN7, CD231)
22445342 This study identified that TSPAN7 as a key molecule for the functional maturation of dendritic spines via PICK1 and ampa receptor trafficking.
22213152 Loss of TSPAN7 is associated with metastasis in clear-cell renal cell carcinoma.
20951001 TM4SF2 was identified as a putative antigenic target in Wegener's granulomatosis
20850477 Studies indicate that The thymus leukemia (TL) antigen and CD8alphaalpha are interacting surface molecules that are expressed at the frontline of the mucosal immune system.
20630051 The interaction of VP26 with tetraspanin-7 plays an essential role in normal HSV-1 replication.
20479760 Observational study of gene-disease association. (HuGE Navigator)
19894777 Both HIV-1 Nef and Vpu downregulate the cell surface expression of tetraspanin 7 (TSPAN7, CD231)
More...

AA Sequence

MASRRMETKPVITCLKTLLIIYSFVFWITGVILLAVGVWGKLTLGTYISLIAENSTNAPYVLIGTGTTIV      1 - 70
VFGLFGCFATCRGSPWMLKLYAMFLSLVFLAELVAGISGFVFRHEIKDTFLRTYTDAMQTYNGNDERSRA     71 - 140
VDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFME    141 - 210
TNMGIIAGVAFGIAFSQLIGMLLACCLSRFITANQYEMV                                   211 - 249
//

Text Mined References (27)

PMID Year Title
25637218 2015 Tetraspanin 7 (TSPAN7) expression is upregulated in multiple myeloma patients and inhibits myeloma tumour development in vivo.
22445342 2012 The X-linked intellectual disability protein TSPAN7 regulates excitatory synapse development and AMPAR trafficking.
22213152 2012 CD31, EDNRB and TSPAN7 are promising prognostic markers in clear-cell renal cell carcinoma revealed by genome-wide expression analyses of primary tumors and metastases.
20951001 2011 Wegener's granuloma harbors B lymphocytes with specificities against a proinflammatory transmembrane protein and a tetraspanin.
20850477 2010 TL and CD8??: Enigmatic partners in mucosal immunity.
20630051 2010 Egress of HSV-1 capsid requires the interaction of VP26 and a cellular tetraspanin membrane protein.
20479760 2011 Systematic resequencing of X-chromosome synaptic genes in autism spectrum disorder and schizophrenia.
19736351 2009 Recurrent rearrangements in synaptic and neurodevelopmental genes and shared biologic pathways in schizophrenia, autism, and mental retardation.
19535787 2009 Novel partners of SPAG11B isoform D in the human male reproductive tract.
19339915 2009 Copy number variation analysis and sequencing of the X-linked mental retardation gene TSPAN7/TM4SF2 in patients with autism spectrum disorder.
More...