Property Summary

NCBI Gene PubMed Count 26
PubMed Score 76.04
PubTator Score 27.05

Knowledge Summary

Patent

No data available

Expression

Gene RIF (16)

PMID Text
25637218 Elevated TSPAN7 may be associated with better outcomes for multiple myeloma patients.
25275127 Both HIV-1 Nef and Vpu downregulate the cell surface expression of tetraspanin 7 (TSPAN7, CD231)
25275127 Both HIV-1 Nef and Vpu downregulate the cell surface expression of tetraspanin 7 (TSPAN7, CD231)
23284715 Both HIV-1 Nef and Vpu downregulate the cell surface expression of tetraspanin 7 (TSPAN7, CD231)
22445342 This study identified that TSPAN7 as a key molecule for the functional maturation of dendritic spines via PICK1 and ampa receptor trafficking.
22213152 Loss of TSPAN7 is associated with metastasis in clear-cell renal cell carcinoma.
20951001 TM4SF2 was identified as a putative antigenic target in Wegener's granulomatosis
20850477 Studies indicate that The thymus leukemia (TL) antigen and CD8alphaalpha are interacting surface molecules that are expressed at the frontline of the mucosal immune system.
20630051 The interaction of VP26 with tetraspanin-7 plays an essential role in normal HSV-1 replication.
20479760 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MASRRMETKPVITCLKTLLIIYSFVFWITGVILLAVGVWGKLTLGTYISLIAENSTNAPYVLIGTGTTIV      1 - 70
VFGLFGCFATCRGSPWMLKLYAMFLSLVFLAELVAGISGFVFRHEIKDTFLRTYTDAMQTYNGNDERSRA     71 - 140
VDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFME    141 - 210
TNMGIIAGVAFGIAFSQLIGMLLACCLSRFITANQYEMV                                   211 - 249
//

Text Mined References (27)

PMID Year Title
25637218 2015 Tetraspanin 7 (TSPAN7) expression is upregulated in multiple myeloma patients and inhibits myeloma tumour development in vivo.
22445342 2012 The X-linked intellectual disability protein TSPAN7 regulates excitatory synapse development and AMPAR trafficking.
22213152 2012 CD31, EDNRB and TSPAN7 are promising prognostic markers in clear-cell renal cell carcinoma revealed by genome-wide expression analyses of primary tumors and metastases.
20951001 2011 Wegener's granuloma harbors B lymphocytes with specificities against a proinflammatory transmembrane protein and a tetraspanin.
20850477 2010 TL and CD8??: Enigmatic partners in mucosal immunity.
20630051 2010 Egress of HSV-1 capsid requires the interaction of VP26 and a cellular tetraspanin membrane protein.
20479760 2011 Systematic resequencing of X-chromosome synaptic genes in autism spectrum disorder and schizophrenia.
19736351 2009 Recurrent rearrangements in synaptic and neurodevelopmental genes and shared biologic pathways in schizophrenia, autism, and mental retardation.
19535787 2009 Novel partners of SPAG11B isoform D in the human male reproductive tract.
19339915 2009 Copy number variation analysis and sequencing of the X-linked mental retardation gene TSPAN7/TM4SF2 in patients with autism spectrum disorder.
More...