Property Summary

NCBI Gene PubMed Count 28
PubMed Score 78.95
PubTator Score 27.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Mental Retardation, X-Linked 58 1 0.0 0.0
Disease Target Count Z-score Confidence
Anorexia nervosa 80 0.0 1.7

Expression

  Differential Expression (26)

Disease log2 FC p
active Crohn's disease -1.410 2.5e-02
active ulcerative colitis -1.371 4.7e-03
atypical teratoid / rhabdoid tumor -3.200 4.3e-07
Breast cancer -1.100 5.5e-07
breast carcinoma -1.300 9.0e-18
colon cancer -2.200 1.5e-02
ductal carcinoma in situ -1.400 1.8e-03
ependymoma -1.100 1.2e-03
glioblastoma -2.500 5.4e-03
group 3 medulloblastoma -1.900 5.0e-04
intraductal papillary-mucinous adenoma (... -2.800 3.4e-06
intraductal papillary-mucinous carcinoma... -2.500 3.9e-05
intraductal papillary-mucinous neoplasm ... -2.300 1.5e-03
invasive ductal carcinoma -3.100 4.3e-04
lung adenocarcinoma -1.859 2.3e-04
lung cancer -3.400 1.5e-05
medulloblastoma, large-cell -2.300 6.6e-08
non-small cell lung cancer -2.004 2.8e-11
ovarian cancer -2.600 2.9e-05
pancreatic cancer -1.200 7.2e-04
pancreatic ductal adenocarcinoma liver m... -1.311 6.6e-04
pediatric high grade glioma -1.200 1.5e-03
Pick disease -1.300 7.8e-03
primary Sjogren syndrome 1.600 1.2e-04
psoriasis -1.500 1.8e-07
subependymal giant cell astrocytoma -1.359 1.7e-02

Gene RIF (19)

AA Sequence

MASRRMETKPVITCLKTLLIIYSFVFWITGVILLAVGVWGKLTLGTYISLIAENSTNAPYVLIGTGTTIV      1 - 70
VFGLFGCFATCRGSPWMLKLYAMFLSLVFLAELVAGISGFVFRHEIKDTFLRTYTDAMQTYNGNDERSRA     71 - 140
VDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTVAATKVNQKGCYDLVTSFME    141 - 210
TNMGIIAGVAFGIAFSQLIGMLLACCLSRFITANQYEMV                                   211 - 249
//

Text Mined References (29)

PMID Year Title