Property Summary

Ligand Count 830
NCBI Gene PubMed Count 450
PubMed Score 1112.41
PubTator Score 668.36

Knowledge Summary

Patent (131,367)

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Celiac disease 116 0.0 2.2

Expression

  Differential Expression (23)

Disease log2 FC p
adult high grade glioma 1.200 1.7e-04
chronic kidney disease 1.400 3.6e-02
cutaneous lupus erythematosus 1.700 1.1e-02
gastric cancer 1.600 1.4e-03
glioblastoma 1.200 5.0e-03
head and neck cancer -1.500 2.2e-02
head and neck cancer and chronic obstruc... 1.300 6.7e-03
hepatocellular carcinoma 2.600 4.2e-06
interstitial cystitis 2.000 2.8e-03
intraductal papillary-mucinous carcinoma... -2.100 2.8e-03
intraductal papillary-mucinous neoplasm ... -2.100 2.3e-02
lung cancer -2.100 6.7e-05
lung carcinoma -1.300 2.7e-15
osteosarcoma -3.575 4.4e-05
ovarian cancer -1.800 2.0e-07
pancreatic cancer 2.900 2.7e-04
pancreatic carcinoma 2.900 2.7e-04
primary Sjogren syndrome 1.800 2.8e-05
psoriasis 1.100 1.9e-06
sarcoidosis 1.500 1.9e-02
tuberculosis 2.800 5.1e-04
ulcerative colitis 1.800 3.6e-05
Waldenstrons macroglobulinemia 1.300 4.5e-02

 OMIM Phenotype (1)

Protein-protein Interaction (3)

Gene RIF (468)

AA Sequence

MLSTSRSRFIRNTNESGEEVTTFFDYDYGAPCHKFDVKQIGAQLLPPLYSLVFIFGFVGNMLVVLILINC      1 - 70
KKLKCLTDIYLLNLAISDLLFLITLPLWAHSAANEWVFGNAMCKLFTGLYHIGYFGGIFFIILLTIDRYL     71 - 140
AIVHAVFALKARTVTFGVVTSVITWLVAVFASVPGIIFTKCQKEDSVYVCGPYFPRGWNNFHTIMRNILG    141 - 210
LVLPLLIMVICYSGILKTLLRCRNEKKRHRAVRVIFTIMIVYFLFWTPYNIVILLNTFQEFFGLSNCEST    211 - 280
SQLDQATQVTETLGMTHCCINPIIYAFVGEKFRSLFHIALGCRIAPLQKPVCGGPGVRPGKNVKVTTQGL    281 - 350
LDGRGKGKSIGRAPEASLQDKEGA                                                  351 - 374
//

Text Mined References (451)

PMID Year Title