Property Summary

NCBI Gene PubMed Count 62
Grant Count 72
R01 Count 52
Funding $6,199,453.4
PubMed Score 482.08
PubTator Score 175.63

Knowledge Summary

Patent (8,933)

Expression

  Differential Expression (6)

Disease log2 FC p
malignant mesothelioma 1.600 0.000
psoriasis -4.000 0.000
osteosarcoma -3.617 0.000
non diabetic and post-ischemic heart fai... 1.200 0.044
adrenocortical carcinoma -3.234 0.000
invasive ductal carcinoma -1.300 0.013

Synonym

Accession P41595 B2R9D5 Q53TI1 Q62221 Q6P523 5-HT-2B
Symbols 5-HT2B
5-HT-2B
5-HT(2B)

Gene

PANTHER Protein Class (2)

PDB

4IB4   4NC3  

  TechDev Info (1)

MLP Assay (14)

AID Type Active / Inconclusive / Inactive Description
434953 screening 0 / 0 / 0 Late-stage radioligand binding dose response assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen Ki
434974 screening 0 / 0 / 0 Late-stage radioligand binding assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen
489017 other 0 / 0 / 0 Counterscreen panel assay for S1P4 antagonists: Ricerca HitProfilingScreen + CYP450
504381 other 0 / 0 / 0 Late-stage radioligand binding assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen Set 2
504400 other 0 / 0 / 0 Late-stage counterscreen panel assay for S1P4 agonists: Ricerca HitProfilingScreen + CYP450
504401 other 0 / 0 / 0 Late-stage counterscreen panel assay for GPR7 antagonists: Ricerca HitProfilingScreen + CYP450
504410 confirmatory 0 / 0 / 0 Late-stage radioligand binding dose response assay to identify inhibitors of NADPH oxidase 1 (NOX1): PDSP screen Ki Set 2
540332 other 0 / 0 / 0 Late-stage counterscreen panel assay for S1P4 agonists: Ricerca HitProfilingScreen + CYP450: Set 2
540345 other 0 / 0 / 0 Late-stage counterscreen panel assay for GPR7 antagonists: Ricerca HitProfilingScreen + CYP450: Set 2
540351 other 0 / 0 / 0 Late-stage counterscreen panel assay for S1P3 agonists: Ricerca HitProfilingScreen + CYP450
More...

Gene RIF (30)

PMID Text
26744351 the 5-HT2B receptor limits degeneration of spinal cord mononuclear phagocytes, most likely microglia, and slows disease progression in amyotrophic lateral sclerosis
26575222 Studies have found that the HTR2B Q20* connected with impulsive behavior and cognitive impulsivity.
24667918 Microarray analysis indicates HIV-1 Tat-induced downregulation of 5-hydroxytryptamine receptor 2B, G protein-coupled (HTR2B) in primary human brain microvascular endothelial cells
24365264 Data indicate that hydrogen bonding interactions with Ser3.36 and Thr3.37 were important for isoflurane binding with the 5HT2B receptor.
24244317 Structure-activity relationships of constrained phenylethylamine ligands for the serotonin 5-HT2 receptors.
24174497 a new and unanticipated role of the 5-HT2B receptor N terminus as a negative modulator, affecting both constitutive and agonist-stimulated activity.
24089568 5-HT2AR, 5-HT2BR, and 5-HT2CR expression in HEK293A cells significantly increases susceptibility to JCPyV infection
23774082 results of the present study suggest that the HTR2B polymorphism is not likely to be associated with personality traits, including novelty seeking and impulsivity.
23519215 study determined the crystal structure of the 5-HT2B receptor bound to ergotamine (ERG) and compared it with the 5-HT1B/ERG structure
23355731 Serotonin skews human macrophage polarization through HTR2B and HTR7.
More...

AA Sequence

MALSYRVSELQSTIPEHILQSTFVHVISSNWSGLQTESIPEEMKQIVEEQGNKLHWAALLILMVIIPTIG      1 - 70
GNTLVILAVSLEKKLQYATNYFLMSLAVADLLVGLFVMPIALLTIMFEAMWPLPLVLCPAWLFLDVLFST     71 - 140
ASIMHLCAISVDRYIAIKKPIQANQYNSRATAFIKITVVWLISIGIAIPVPIKGIETDVDNPNNITCVLT    141 - 210
KERFGDFMLFGSLAAFFTPLAIMIVTYFLTIHALQKKAYLVKNKPPQRLTWLTVSTVFQRDETPCSSPEK    211 - 280
VAMLDGSRKDKALPNSGDETLMRRTSTIGKKSVQTISNEQRASKVLGIVFFLFLLMWCPFFITNITLVLC    281 - 350
DSCNQTTLQMLLEIFVWIGYVSSGVNPLVYTLFNKTFRDAFGRYITCNYRATKSVKTLRKRSSKIYFRNP    351 - 420
MAENSKFFKKHGIRNGINPAMYQSPMRLRSSTIQSSSIILLDTLLLTENEGDKTEEQVSYV             421 - 481
//

Text Mined References (66)

PMID Year Title
26744351 2016 Serotonin 2B receptor slows disease progression and prevents degeneration of spinal cord mononuclear phagocytes in amyotrophic lateral sclerosis.
26733006 2016 Serotonin (5-HT) receptor 2b activation augments glucose-stimulated insulin secretion in human and mouse islets of Langerhans.
26575222 2015 Impulsive alcohol-related risk-behavior and emotional dysregulation among individuals with a serotonin 2B receptor stop codon.
24365264 2015 Molecular interactions between general anesthetics and the 5HT2B receptor.
24244317 2013 Structure-activity relationships of constrained phenylethylamine ligands for the serotonin 5-HT2 receptors.
24174497 2014 Role of the N-terminal region in G protein-coupled receptor functions: negative modulation revealed by 5-HT2B receptor polymorphisms.
24089568 2013 5-HT2 receptors facilitate JC polyomavirus entry.
23774082 2013 No association between a polymorphism in the serotonin receptor 2B (HTR2B) gene and personality traits in healthy Japanese subjects.
23519215 2013 Structural features for functional selectivity at serotonin receptors.
23519210 2013 Structural basis for molecular recognition at serotonin receptors.
More...