Property Summary

NCBI Gene PubMed Count 77
Grant Count 527
R01 Count 309
Funding $83,373,432.33
PubMed Score 1295.52
PubTator Score 75.46

Knowledge Summary

Patent (62,373)

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -2.900 0.003
posterior fossa group A ependymoma -3.800 0.000
oligodendroglioma -2.100 0.000
glioblastoma -4.000 0.000
medulloblastoma -3.900 0.000
atypical teratoid / rhabdoid tumor -3.900 0.000
medulloblastoma, large-cell -3.600 0.000
adult high grade glioma -3.300 0.000
pituitary cancer 1.800 0.026
psoriasis -1.200 0.034

Synonym

Accession P41594 Q6J164 mGluR5
Symbols mGlu5
GPRC1E
MGLUR5
PPP1R86

Gene

PANTHER Protein Class (2)

PDB

3LMK   4OO9   5CGC   5CGD  

  TechDev Info (1)

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
588737 other 2 / 0 / 0 hmGluR5_Calcium_Fold_Shift
743419 confirmatory 0 / 0 / 1 Selectivity Studies of mglur8 probe at mglur5

Gene RIF (66)

PMID Text
26667279 The interaction between GRM5 and cellular prion protein has a central role in transgenic mouse model of Alzheimer's disease pathogenesis.
26645628 The metabotropic glutamate receptor subtype 5 (mGluR5) has been implicated in the pathophysiology of mood and anxiety disorders.
26311002 Data suggest that metabotropic glutamate receptors recycling is completely dependent on the activity of PP2A whereas, PP2B has partial effect on this process.
26052099 findings provide evidence for decreased expression of metabotropic glutamate receptor 5 and its signaling components representing a key pathophysiological hallmark in autism spectrum disorder.
26048293 Study provided evidence that protein expression of mGluR5 is significantly higher (total: 42%; monomer: 25%; dimer: 52%) in the hippocampal CA1 region of schizophrenia subjects relative to healthy controls
25778620 Results provide compelling evidence that mGluR5 regulation is altered in schizophrenia, likely contributing to the altered glutamatergic signaling that is associated with the disorder
25704074 This review supports altered mGluR5 functioning as a convergent point in ASD pathogenesis and indicates more research is warranted into mGluR5 as a potential therapeutic target.
25613138 The gene expression of GRM5 is significantly upregulated in both clade B and clade C Tat treated SK-N-MC neuroblastoma cells
25115540 Findings demonstrate a developmental regulation of mGluR5 in the hippocampus and suggest a role for this receptor in astrocytes during early development in Down's syndrome hippocampus
25003238 reflected in the immunoblotting data Mglur5 receptors were detected at higher levels of expression in patient with cortical dysplasia with intractable epilepsy.
More...

AA Sequence

MVLLLILSVLLLKEDVRGSAQSSERRVVAHMPGDIIIGALFSVHHQPTVDKVHERKCGAVREQYGIQRVE      1 - 70
AMLHTLERINSDPTLLPNITLGCEIRDSCWHSAVALEQSIEFIRDSLISSEEEEGLVRCVDGSSSSFRSK     71 - 140
KPIVGVIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLSDKTLFKYFMRVVPSDAQQARAMVDIVKRYN    141 - 210
WTYVSAVHTEGNYGESGMEAFKDMSAKEGICIAHSYKIYSNAGEQSFDKLLKKLTSHLPKARVVACFCEG    211 - 280
MTVRGLLMAMRRLGLAGEFLLLGSDGWADRYDVTDGYQREAVGGITIKLQSPDVKWFDDYYLKLRPETNH    281 - 350
RNPWFQEFWQHRFQCRLEGFPQENSKYNKTCNSSLTLKTHHVQDSKMGFVINAIYSMAYGLHNMQMSLCP    351 - 420
GYAGLCDAMKPIDGRKLLESLMKTNFTGVSGDTILFDENGDSPGRYEIMNFKEMGKDYFDYINVGSWDNG    421 - 490
ELKMDDDEVWSKKSNIIRSVCSEPCEKGQIKVIRKGEVSCCWTCTPCKENEYVFDEYTCKACQLGSWPTD    491 - 560
DLTGCDLIPVQYLRWGDPEPIAAVVFACLGLLATLFVTVVFIIYRDTPVVKSSSRELCYIILAGICLGYL    561 - 630
CTFCLIAKPKQIYCYLQRIGIGLSPAMSYSALVTKTNRIARILAGSKKKICTKKPRFMSACAQLVIAFIL    631 - 700
ICIQLGIIVALFIMEPPDIMHDYPSIREVYLICNTTNLGVVTPLGYNGLLILSCTFYAFKTRNVPANFNE    701 - 770
AKYIAFTMYTTCIIWLAFVPIYFGSNYKIITMCFSVSLSATVALGCMFVPKVYIILAKPERNVRSAFTTS    771 - 840
TVVRMHVGDGKSSSAASRSSSLVNLWKRRGSSGETLRYKDRRLAQHKSEIECFTPKGSMGNGGRATMSSS    841 - 910
NGKSVTWAQNEKSSRGQHLWQRLSIHINKKENPNQTAVIKPFPKSTESRGLGAGAGAGGSAGGVGATGGA    911 - 980
GCAGAGPGGPESPDAGPKALYDVAEAEEHFPAPARPRSPSPISTLSHRAGSASRTDDDVPSLHSEPVARS    981 - 1050
SSSQGSLMEQISSVVTRFTANISELNSMMLSTAAPSPGVGAPLCSSYLIPKEIQLPTTMTTFAEIQPLPA   1051 - 1120
IEVTGGAQPAAGAQAAGDAARESPAAGPEAAAAKPDLEELVALTPPSPFRDSVDSGSTTPNSPVSESALC   1121 - 1190
IPSSPKYDTLIIRDYTQSSSSL                                                   1191 - 1212
//

Text Mined References (78)

PMID Year Title
26667279 2016 Metabotropic glutamate receptor 5 couples cellular prion protein to intracellular signalling in Alzheimer's disease.
26645628 2015 Characterization of brain mGluR5 binding in a pilot study of late-life major depressive disorder using positron emission tomography and [¹¹C]ABP688.
26311002 2015 Differential effects of protein phosphatases in the recycling of metabotropic glutamate receptor 5.
26052099 2015 Decreased expression of mGluR5 within the dorsolateral prefrontal cortex in autism and increased microglial number in mGluR5 knockout mice: Pathophysiological and neurobehavioral implications.
26048293 2015 Metabotropic glutamate receptor 5, and its trafficking molecules Norbin and Tamalin, are increased in the CA1 hippocampal region of subjects with schizophrenia.
25778620 2015 Alterations of mGluR5 and its endogenous regulators Norbin, Tamalin and Preso1 in schizophrenia: towards a model of mGluR5 dysregulation.
25704074 2015 Convergent evidence for mGluR5 in synaptic and neuroinflammatory pathways implicated in ASD.
25115540 2014 Metabotropic glutamate receptor 5 in Down's syndrome hippocampus during development: increased expression in astrocytes.
25003238 2014 Expression of astrocyte-related receptors in cortical dysplasia with intractable epilepsy.
24969128 2015 Decrease of mGluR5 receptor density goes parallel with changes in enkephalin and substance P immunoreactivity in Huntington's disease: a preliminary investigation in the postmortem human brain.
More...