Property Summary

Ligand Count 661
NCBI Gene PubMed Count 81
PubMed Score 1370.27
PubTator Score 75.46

Knowledge Summary

Patent (62,373)

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.3
Kidney cancer 2613 0.0 0.7

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -3.300 5.9e-05
astrocytic glioma -2.900 3.0e-03
atypical teratoid / rhabdoid tumor -1.200 4.6e-06
ependymoma -3.600 1.0e-03
glioblastoma -3.000 8.0e-06
group 3 medulloblastoma -3.700 2.9e-04
medulloblastoma, large-cell -1.100 7.7e-03
oligodendroglioma -2.000 1.6e-02
pituitary cancer 1.800 2.6e-02
psoriasis -1.200 3.4e-02

Gene RIF (69)

AA Sequence

MVLLLILSVLLLKEDVRGSAQSSERRVVAHMPGDIIIGALFSVHHQPTVDKVHERKCGAVREQYGIQRVE      1 - 70
AMLHTLERINSDPTLLPNITLGCEIRDSCWHSAVALEQSIEFIRDSLISSEEEEGLVRCVDGSSSSFRSK     71 - 140
KPIVGVIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLSDKTLFKYFMRVVPSDAQQARAMVDIVKRYN    141 - 210
WTYVSAVHTEGNYGESGMEAFKDMSAKEGICIAHSYKIYSNAGEQSFDKLLKKLTSHLPKARVVACFCEG    211 - 280
MTVRGLLMAMRRLGLAGEFLLLGSDGWADRYDVTDGYQREAVGGITIKLQSPDVKWFDDYYLKLRPETNH    281 - 350
RNPWFQEFWQHRFQCRLEGFPQENSKYNKTCNSSLTLKTHHVQDSKMGFVINAIYSMAYGLHNMQMSLCP    351 - 420
GYAGLCDAMKPIDGRKLLESLMKTNFTGVSGDTILFDENGDSPGRYEIMNFKEMGKDYFDYINVGSWDNG    421 - 490
ELKMDDDEVWSKKSNIIRSVCSEPCEKGQIKVIRKGEVSCCWTCTPCKENEYVFDEYTCKACQLGSWPTD    491 - 560
DLTGCDLIPVQYLRWGDPEPIAAVVFACLGLLATLFVTVVFIIYRDTPVVKSSSRELCYIILAGICLGYL    561 - 630
CTFCLIAKPKQIYCYLQRIGIGLSPAMSYSALVTKTNRIARILAGSKKKICTKKPRFMSACAQLVIAFIL    631 - 700
ICIQLGIIVALFIMEPPDIMHDYPSIREVYLICNTTNLGVVTPLGYNGLLILSCTFYAFKTRNVPANFNE    701 - 770
AKYIAFTMYTTCIIWLAFVPIYFGSNYKIITMCFSVSLSATVALGCMFVPKVYIILAKPERNVRSAFTTS    771 - 840
TVVRMHVGDGKSSSAASRSSSLVNLWKRRGSSGETLRYKDRRLAQHKSEIECFTPKGSMGNGGRATMSSS    841 - 910
NGKSVTWAQNEKSSRGQHLWQRLSIHINKKENPNQTAVIKPFPKSTESRGLGAGAGAGGSAGGVGATGGA    911 - 980
GCAGAGPGGPESPDAGPKALYDVAEAEEHFPAPARPRSPSPISTLSHRAGSASRTDDDVPSLHSEPVARS    981 - 1050
SSSQGSLMEQISSVVTRFTANISELNSMMLSTAAPSPGVGAPLCSSYLIPKEIQLPTTMTTFAEIQPLPA   1051 - 1120
IEVTGGAQPAAGAQAAGDAARESPAAGPEAAAAKPDLEELVALTPPSPFRDSVDSGSTTPNSPVSESALC   1121 - 1190
IPSSPKYDTLIIRDYTQSSSSL                                                   1191 - 1212
//

Text Mined References (82)

PMID Year Title